Project name: 95e53a91a18908b

Status: done

Started: 2026-06-22 16:07:23
Settings
Chain sequence(s) B: MEKLMQAKELLKEMKSRLAAAKTPEEVLELYREFVGVAREIGQLMAEAEA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:28)
Show buried residues

Minimal score value
-4.0994
Maximal score value
0.4247
Average score
-1.5881
Total score value
-79.4073

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 0.0089
2 E B -1.7065
3 K B -2.0096
4 L B -0.9361
5 M B -0.9843
6 Q B -2.0078
7 A B 0.0000
8 K B -2.8223
9 E B -3.5160
10 L B -2.2263
11 L B -2.2614
12 K B -4.0994
13 E B -3.8996
14 M B 0.0000
15 K B -3.0983
16 S B -2.3654
17 R B -2.3307
18 L B -1.3509
19 A B -1.0032
20 A B -0.9909
21 A B -1.7494
22 K B -2.2312
23 T B -1.8891
24 P B -1.7010
25 E B -2.5672
26 E B -2.6382
27 V B -1.1793
28 L B -0.6566
29 E B -2.3067
30 L B 0.0000
31 Y B 0.3484
32 R B -1.3333
33 E B -0.6910
34 F B 0.3165
35 V B 0.4247
36 G B -0.7843
37 V B -0.5397
38 A B -0.7589
39 R B -2.3609
40 E B -2.2524
41 I B -1.6865
42 G B -1.7382
43 Q B -2.5327
44 L B -1.7854
45 M B -1.1190
46 A B -1.5411
47 E B -2.0032
48 A B -1.6337
49 E B -2.0655
50 A B -1.1526
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018