Project name: 9623fe4e701b5f7

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFIFSSYSMGWFRQAPGKGLEGVSYISITGSTTTYADSVKGRFTISRDNAKNTLYLQMNSLRAEDTAVYYCAVLSAPGTPPWLQNYGGDYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:44)

• Minimal score value: -2.7814
• Maximal score value: 1.9151
• Average score: -0.5383
• Total score value: -67.2894

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	A	-2.0309
2	V	A	-1.0622
3	Q	A	-1.3634
4	L	A	0.0000
5	V	A	0.4271
6	E	A	0.0000
7	S	A	-0.1989
8	G	A	-0.6052
9	G	A	0.2658
10	G	A	0.7093
11	L	A	1.3088
12	V	A	0.0000
13	Q	A	-1.4972
14	P	A	-1.8961
15	G	A	-1.5623
16	G	A	-1.0886
17	S	A	-1.2733
18	L	A	-1.0901
19	R	A	-2.2397
20	L	A	0.0000
21	S	A	-0.4900
22	C	A	0.0000
23	A	A	-0.4101
24	A	A	0.0000
25	S	A	-0.6899
26	G	A	-0.7485
27	F	A	0.6590
28	I	A	1.9151
29	F	A	0.0000
30	S	A	0.1701
31	S	A	0.7224
32	Y	A	0.8748
33	S	A	0.0000
34	M	A	0.0000
35	G	A	0.0000
36	W	A	0.0000
37	F	A	0.0000
38	R	A	0.0000
39	Q	A	-0.9285
40	A	A	-1.2436
41	P	A	-1.3407
42	G	A	-1.5799
43	K	A	-2.3564
44	G	A	-1.5098
45	L	A	-0.5606
46	E	A	-0.4528
47	G	A	0.0000
48	V	A	0.0000
49	S	A	0.0000
50	Y	A	0.0000
51	I	A	0.0000
52	S	A	0.0000
53	I	A	0.2277
54	T	A	-0.1898
55	G	A	-0.3835
56	S	A	-0.3107
57	T	A	-0.2571
58	T	A	-0.1697
59	T	A	-0.4013
60	Y	A	-0.8973
61	A	A	-1.2893
62	D	A	-2.4643
63	S	A	-1.7570
64	V	A	0.0000
65	K	A	-2.5805
66	G	A	-1.7597
67	R	A	-1.5247
68	F	A	0.0000
69	T	A	-1.0044
70	I	A	0.0000
71	S	A	-0.5632
72	R	A	-0.9138
73	D	A	-1.5383
74	N	A	-1.3605
75	A	A	-1.4396
76	K	A	-2.3556
77	N	A	-1.5505
78	T	A	-1.0786
79	L	A	0.0000
80	Y	A	-0.6198
81	L	A	0.0000
82	Q	A	-1.5831
83	M	A	0.0000
84	N	A	-1.5942
85	S	A	-1.4177
86	L	A	0.0000
87	R	A	-2.7814
88	A	A	-1.9829
89	E	A	-2.4316
90	D	A	0.0000
91	T	A	-0.5598
92	A	A	0.0000
93	V	A	0.7378
94	Y	A	0.0000
95	Y	A	0.3399
96	C	A	0.0000
97	A	A	0.0000
98	V	A	0.0000
99	L	A	0.0000
100	S	A	-0.3673
101	A	A	-0.1767
102	P	A	-0.2654
103	G	A	-0.3547
104	T	A	-0.2172
105	P	A	-0.3854
106	P	A	-0.8310
107	W	A	0.0000
108	L	A	-0.2785
109	Q	A	-1.5113
110	N	A	-1.7028
111	Y	A	-0.7495
112	G	A	-1.0433
113	G	A	-0.5768
114	D	A	-0.8217
115	Y	A	-0.0592
116	W	A	0.1715
117	G	A	-0.1890
118	Q	A	-0.8117
119	G	A	0.0000
120	T	A	0.6022
121	L	A	1.6010
122	V	A	0.0000
123	T	A	0.2501
124	V	A	0.0000
125	S	A	-0.9519