Project name: query_structure

Status: done

Started: 2026-03-17 01:22:36
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVDHYYITYGETGHYWYYQAFAVPGSKSTATISGLSPGVDYTITVYASVLYGSRYYSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:28)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:30)
Show buried residues

Minimal score value
-2.6789
Maximal score value
2.3648
Average score
-0.1652
Total score value
-15.1968

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8235
2 S A 0.8665
3 S A 1.0620
4 V A 0.8725
5 P A 0.0000
6 T A -1.6119
7 K A -2.6789
8 L A 0.0000
9 E A -1.9114
10 V A 0.1138
11 V A 1.5470
12 A A 0.8982
13 A A 0.3249
14 T A -0.1981
15 P A -0.8084
16 T A -0.5388
17 S A -0.3188
18 L A 0.0000
19 L A 0.7486
20 I A 0.0000
21 S A -0.9539
22 W A 0.0000
23 D A -2.6169
24 A A -1.1993
25 P A 0.0826
26 A A 0.5104
27 V A 0.6957
28 T A 0.0213
29 V A -0.4632
30 D A -1.6617
31 H A -1.2719
32 Y A 0.0000
33 Y A 0.6248
34 I A 0.0000
35 T A 0.0000
36 Y A 0.0000
37 G A 0.0000
38 E A -0.6891
39 T A -0.9740
40 G A -0.5494
41 H A 0.2630
42 Y A 2.0087
43 W A 2.3648
44 Y A 2.3481
45 Y A 1.9740
46 Q A 0.3444
47 A A 0.4353
48 F A 0.5111
49 A A 0.3539
50 V A 0.0000
51 P A -1.2762
52 G A -1.5455
53 S A -1.4722
54 K A -2.2275
55 S A -1.4388
56 T A -0.7292
57 A A 0.0000
58 T A 0.2392
59 I A 0.0000
60 S A -0.4776
61 G A -0.6886
62 L A 0.0000
63 S A -0.9142
64 P A -1.0754
65 G A -1.2305
66 V A -1.1967
67 D A -2.4654
68 Y A 0.0000
69 T A -0.8738
70 I A 0.0000
71 T A 0.1405
72 V A 0.0000
73 Y A 0.6366
74 A A 0.0000
75 S A 0.2097
76 V A 0.9071
77 L A 1.6135
78 Y A 1.7866
79 G A 0.3411
80 S A 0.0524
81 R A -0.6122
82 Y A 1.1033
83 Y A 0.9207
84 S A 0.6595
85 P A 0.5100
86 I A 0.2210
87 S A -0.5077
88 I A -0.7288
89 N A -1.8680
90 Y A -1.6360
91 R A -2.5935
92 T A -1.3296
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018