Project name: 96a443a2791a177

Status: done

Started: 2026-07-01 15:23:40
Settings
Chain sequence(s) B: SSKLIQDHLVQVSAGGPLSSITWVWGGDATLTTDLTLPAGETVRLRAETA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:30)
Show buried residues

Minimal score value
-3.0004
Maximal score value
1.8494
Average score
-0.8272
Total score value
-41.3577

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S B -0.8116
2 S B -1.2127
3 K B -1.8211
4 L B -1.1488
5 I B -0.3880
6 Q B -1.9429
7 D B -2.5599
8 H B -2.3198
9 L B -1.0592
10 V B -0.9530
11 Q B -1.6820
12 V B 0.0000
13 S B -0.9795
14 A B -0.8938
15 G B -0.6790
16 G B -0.5916
17 P B -0.5342
18 L B -0.2507
19 S B -0.4520
20 S B -0.6047
21 I B 0.2680
22 T B 0.6732
23 W B 1.4144
24 V B 1.8494
25 W B 0.7432
26 G B -0.4778
27 G B -1.0265
28 D B -1.3704
29 A B -0.0506
30 T B 0.8447
31 L B 1.4497
32 T B 0.4422
33 T B -0.4855
34 D B -1.5592
35 L B -0.3549
36 T B -0.3210
37 L B 0.0000
38 P B -0.8680
39 A B -1.1541
40 G B -1.5354
41 E B -2.0694
42 T B -1.3581
43 V B -1.3339
44 R B -2.4758
45 L B -2.2394
46 R B -3.0004
47 A B -2.1339
48 E B -2.2680
49 T B -1.2977
50 A B -0.7780
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018