Project name: 96a988365c06afc

Status: done

Started: 2026-06-22 16:07:14
Settings
Chain sequence(s) B: MAALMEAKKLLKEMKSRLAAAKTPEEVLALWEELVAVAKKIGALIAAAKA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:29)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:29)
Show buried residues

Minimal score value
-4.0756
Maximal score value
1.0882
Average score
-0.9319
Total score value
-46.5945

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B 1.0882
2 A B 0.1524
3 A B -0.3399
4 L B -0.0410
5 M B -0.8356
6 E B -2.3407
7 A B 0.0000
8 K B -2.8679
9 K B -3.7270
10 L B -2.4684
11 L B -2.6102
12 K B -4.0756
13 E B -3.7500
14 M B 0.0000
15 K B -2.9626
16 S B -2.1422
17 R B -2.0116
18 L B -0.7305
19 A B -0.7230
20 A B -0.7727
21 A B -1.2071
22 K B -2.0741
23 T B -1.4512
24 P B -1.1282
25 E B -1.7558
26 E B -1.5596
27 V B 0.1424
28 L B 0.8768
29 A B -0.1400
30 L B 0.0000
31 W B 0.9183
32 E B -0.8244
33 E B -0.5441
34 L B 0.0532
35 V B -0.3269
36 A B -0.8607
37 V B 0.0000
38 A B -0.8756
39 K B -1.7644
40 K B -1.1576
41 I B -0.4498
42 G B -0.4168
43 A B -0.3346
44 L B 0.4795
45 I B 0.6670
46 A B 0.0738
47 A B 0.0933
48 A B -0.1046
49 K B -1.2582
50 A B -0.5068
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018