Project name: Mb5-11_I18L_I104L_LLLFLF_Lib2_Lib3_overlap

Status: done

Started: 2026-07-06 07:10:51
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQLSWDAFHRYHNGFTHPVRYYRLTYGETGGNSPVQEFTVPGSKSTATLSGLKPGVDYTFTVYAVTWYPRYGYGESGPLSFNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:24)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:25)
Show buried residues

Minimal score value
-2.8459
Maximal score value
1.5043
Average score
-0.7562
Total score value
-82.4206

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.3878
2 Q A -0.9538
3 A A -1.1293
4 N A -1.8752
5 S A -1.3744
6 G A 0.0000
7 S A -1.1960
8 L A 0.0000
9 E A -1.7126
10 V A -0.5976
11 V A 0.1708
12 E A -1.4386
13 A A -1.1580
14 S A -1.3036
15 P A -1.8667
16 T A -1.2257
17 S A -1.1822
18 L A 0.0000
19 Q A -1.0907
20 L A 0.0000
21 S A -1.0618
22 W A 0.0000
23 D A -2.1739
24 A A -1.4465
25 F A 0.0000
26 H A -1.0925
27 R A 0.0000
28 Y A 0.9394
29 H A 0.2878
30 N A -0.5791
31 G A 0.1237
32 F A 1.5043
33 T A 0.7554
34 H A 0.0308
35 P A -0.4321
36 V A -1.0211
37 R A -1.5519
38 Y A -0.8607
39 Y A 0.0000
40 R A -0.8048
41 L A 0.0000
42 T A -0.6777
43 Y A -0.3813
44 G A -0.7768
45 E A -1.6904
46 T A -1.3896
47 G A -1.2831
48 G A -1.3869
49 N A -1.5287
50 S A -0.9089
51 P A -0.4206
52 V A 0.2789
53 Q A -1.2194
54 E A -1.8161
55 F A -0.7101
56 T A -0.1755
57 V A -0.4292
58 P A -0.9640
59 G A -1.2570
60 S A -1.2754
61 K A -1.9509
62 S A -1.1998
63 T A -0.8821
64 A A 0.0000
65 T A -0.4554
66 L A 0.0000
67 S A -0.8101
68 G A -1.0017
69 L A 0.0000
70 K A -2.5413
71 P A -2.1648
72 G A -1.4877
73 V A -1.5767
74 D A -2.6830
75 Y A 0.0000
76 T A -0.8653
77 F A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.2933
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.5256
85 Y A 0.0000
86 P A -0.4542
87 R A -1.1021
88 Y A 0.7183
89 G A 0.7144
90 Y A 1.1082
91 G A 0.4782
92 E A -0.7205
93 S A 0.0000
94 G A -0.7992
95 P A -0.4506
96 L A 0.0044
97 S A -0.3720
98 F A -0.3993
99 N A -1.7553
100 Y A -1.7410
101 R A -2.8115
102 T A 0.0000
103 E A -2.2722
104 L A -1.4432
105 D A -2.8007
106 K A -2.8459
107 P A -1.8434
108 S A -1.6436
109 Q A -1.6623
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018