Project name: 9757434e31bbd8

Chain sequence(s)	A: MNFGAFSINPAMMAAAQAALQSSWGMMGMLASQQNQSGPSGNNQNQGNMQ
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:17)

• Minimal score value: -3.5915
• Maximal score value: 2.379
• Average score: -0.3709
• Total score value: -18.5471

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
311	M	A	0.8354
312	N	A	0.0874
313	F	A	1.5763
314	G	A	1.1797
315	A	A	1.4290
316	F	A	2.3790
317	S	A	1.5758
318	I	A	1.7538
319	N	A	-0.0204
320	P	A	0.1949
321	A	A	0.4813
322	M	A	1.1459
323	M	A	0.9807
324	A	A	0.4880
325	A	A	0.5170
326	A	A	0.5331
327	Q	A	0.0314
328	A	A	0.0948
329	A	A	0.3474
330	L	A	1.0773
331	Q	A	-0.0765
332	S	A	0.2083
333	S	A	0.5938
334	W	A	1.3770
335	G	A	0.7792
336	M	A	1.5892
337	M	A	1.5689
338	G	A	0.6935
339	M	A	1.0102
340	L	A	0.3689
341	A	A	-0.5588
342	S	A	-0.9285
343	Q	A	-1.9863
344	Q	A	-2.8085
345	N	A	-2.7187
346	Q	A	-2.5991
347	S	A	-2.2639
348	G	A	-1.6498
349	P	A	-1.4884
350	S	A	-1.3442
351	G	A	-2.2290
352	N	A	-3.1878
353	N	A	-3.0958
354	Q	A	-3.5915
355	N	A	-3.1849
356	Q	A	-3.0768
357	G	A	-2.6557
358	N	A	-2.1556
359	M	A	-0.4648
360	Q	A	-1.3593