Project name: query_structure

Status: done

Started: 2026-03-16 23:02:21
Settings
Chain sequence(s) A: CVATRNSCKPPAPACCDPCASCYCRFFRSACYCRVLSLNC
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:16)
Show buried residues

Minimal score value
-2.3898
Maximal score value
1.5667
Average score
-0.1604
Total score value
-6.4149

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
93 C A 0.9576
94 V A 0.2236
95 A A -0.2885
96 T A -1.0383
97 R A -2.3898
98 N A -2.1196
99 S A -1.1814
100 C A -1.0329
101 K A -1.6576
102 P A -0.9870
103 P A -0.8148
104 A A -0.5694
105 P A -0.4339
106 A A -0.5731
107 C A 0.0000
108 C A 0.1799
109 D A -0.8955
110 P A -0.5928
111 C A 0.1106
112 A A 0.1689
113 S A -0.0224
114 C A -0.4128
115 Y A 0.9504
116 C A 0.2708
117 R A -0.3024
118 F A 1.5370
119 F A 1.5667
120 R A -0.5705
121 S A -0.0053
122 A A -0.2638
123 C A -0.1060
124 Y A -0.9856
125 C A 0.0000
126 R A -0.3173
127 V A 1.0371
128 L A 1.2211
129 S A 1.0069
130 L A 1.3724
131 N A -0.0289
132 C A 0.5717
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018