Project name: 9774bdd089eb0ea

Chain sequence(s)	A: GAAVCALKGCGVGLVRLVQVCEDRCLIEATIDGLSPHTHEVKVHEYGDLSNGGESCGDVYTDGHIGLLTPDSTGRASLQMTSTQLKVWNVIGRSIVVHEVLPDRPQNRLLCGVIAKSAGLF
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:57)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:58)

• Minimal score value: -3.2117
• Maximal score value: 2.6597
• Average score: -0.6138
• Total score value: -74.2711

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
77	G	A	-0.2432
78	A	A	0.1339
79	A	A	0.0000
80	V	A	-0.0827
81	C	A	0.0000
82	A	A	0.4327
83	L	A	0.0000
84	K	A	-0.8802
85	G	A	-0.3379
86	C	A	0.5007
87	G	A	0.3189
88	V	A	1.2662
89	G	A	0.0000
90	L	A	0.7003
91	V	A	0.0000
92	R	A	-0.5353
93	L	A	0.0000
94	V	A	0.8011
95	Q	A	0.0000
96	V	A	0.9784
97	C	A	-0.6845
98	E	A	-2.7142
99	D	A	-3.1744
100	R	A	-2.1043
101	C	A	0.0000
102	L	A	0.1335
103	I	A	0.0000
104	E	A	-0.8744
105	A	A	-0.3614
106	T	A	-0.1877
107	I	A	0.0000
108	D	A	-0.7968
109	G	A	-0.5132
110	L	A	0.0000
111	S	A	-1.2082
112	P	A	-1.5689
113	H	A	-1.4672
114	T	A	-0.6475
115	H	A	0.0000
116	E	A	0.0000
117	V	A	0.0000
118	K	A	-0.6909
119	V	A	0.0000
120	H	A	0.0000
121	E	A	-0.7136
122	Y	A	-0.0119
123	G	A	-0.4677
124	D	A	-1.6940
125	L	A	-1.2383
126	S	A	-1.5572
127	N	A	-2.3291
128	G	A	-2.0728
129	G	A	-1.9160
130	E	A	-2.9344
131	S	A	-1.9902
132	C	A	0.0000
133	G	A	-1.3561
134	D	A	-1.7500
135	V	A	-0.5436
136	Y	A	-0.4923
137	T	A	-0.6339
138	D	A	-0.9033
139	G	A	0.0000
140	H	A	-1.0043
141	I	A	-0.3742
142	G	A	0.0380
143	L	A	0.4181
144	L	A	0.0000
145	T	A	-0.6607
146	P	A	0.0000
147	D	A	-2.2117
148	S	A	-1.3528
149	T	A	-1.1370
150	G	A	0.0000
151	R	A	-2.1320
152	A	A	0.0000
153	S	A	-0.7645
154	L	A	-0.3031
155	Q	A	-1.1410
156	M	A	-0.4185
157	T	A	-0.5478
158	S	A	-1.0965
159	T	A	-2.0166
160	Q	A	-2.2138
161	L	A	0.0000
162	K	A	-1.0306
163	V	A	0.0000
164	W	A	0.6951
165	N	A	0.0516
166	V	A	0.0000
167	I	A	0.1431
168	G	A	-0.4393
169	R	A	-0.1039
170	S	A	0.0000
171	I	A	0.0000
172	V	A	0.0000
173	V	A	0.0000
174	H	A	-1.2989
175	E	A	-1.7921
176	V	A	-1.4040
177	L	A	-1.0644
178	P	A	-1.6650
179	D	A	-2.6652
180	R	A	-3.2117
181	P	A	-2.4936
182	Q	A	-2.8123
183	N	A	-2.6973
184	R	A	-1.9083
185	L	A	-0.8317
186	L	A	0.0000
187	C	A	0.0000
188	G	A	0.0000
189	V	A	0.2467
190	I	A	0.0000
191	A	A	-0.6377
192	K	A	-1.5220
193	S	A	-0.6658
194	A	A	0.2418
195	G	A	0.8518
196	L	A	2.4129
197	F	A	2.6597