Project name: obj1 [mutate: EA1C, QA39C, KG43C, DI62C, KF76C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	DI62C,EA1C,KF76C,QA39C,KG43C
Energy difference between WT (input) and mutated protein (by FoldX)	2.70678 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:15)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:35)

• Minimal score value: -3.3298
• Maximal score value: 1.8862
• Average score: -0.3865
• Total score value: -46.378

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	C	-0.1055	mutated: EA1C
2	V	C	0.0051
3	Q	C	-0.8348
4	L	C	0.0000
5	V	C	0.5485
6	E	C	0.2188
7	S	C	-0.4030
8	G	C	-0.8088
9	G	C	0.0306
10	G	C	0.9389
11	L	C	1.4406
12	V	C	-0.0385
13	Q	C	-1.3371
14	P	C	-1.4887
15	G	C	-1.4134
16	G	C	-0.9785
17	S	C	-1.2309
18	L	C	-0.9630
19	R	C	-2.1331
20	L	C	0.0000
21	S	C	-0.5191
22	C	C	0.0000
23	A	C	0.3829
24	A	C	0.0000
25	S	C	0.0537
26	D	C	0.0000
27	F	C	1.5479
28	T	C	0.2540
29	F	C	0.0000
30	R	C	-2.0069
31	S	C	-0.8867
32	Y	C	-1.2168
33	E	C	-1.1447
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	A	C	0.4794	mutated: QA39C
40	A	C	-0.3291
41	P	C	-0.7806
42	G	C	-0.7712
43	G	C	-0.8006	mutated: KG43C
44	G	C	-0.3622
45	L	C	0.8082
46	E	C	-0.1213
47	W	C	0.3872
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5842
53	G	C	-1.2262
54	S	C	-1.2016
55	G	C	-1.0537
56	G	C	-0.7345
57	S	C	-0.3027
58	T	C	0.1987
59	Y	C	1.0204
60	Y	C	0.5807
61	A	C	0.6940
62	I	C	1.4601	mutated: DI62C
63	S	C	0.1130
64	V	C	0.0000
65	K	C	-1.1132
66	G	C	-1.1094
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6626
70	I	C	0.0000
71	S	C	-0.5028
72	R	C	-0.7525
73	D	C	-0.6406
74	N	C	-0.9276
75	S	C	0.0022
76	F	C	1.3843	mutated: KF76C
77	N	C	0.1374
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.5801
81	L	C	0.0000
82	Q	C	-1.2190
83	M	C	0.0000
84	N	C	-1.3327
85	S	C	-1.2322
86	L	C	0.0000
87	R	C	-2.4721
88	A	C	-1.8894
89	E	C	-2.3409
90	D	C	0.0000
91	T	C	-0.3247
92	A	C	0.0000
93	I	C	1.3778
94	Y	C	0.0000
95	Y	C	0.7387
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1644
101	D	C	-3.3298
102	G	C	-2.0850
103	F	C	-1.2304
104	N	C	-2.4263
105	K	C	-3.1795
106	G	C	-1.8834
107	F	C	-0.9554
108	D	C	-0.8739
109	Y	C	0.1082
110	W	C	0.4794
111	G	C	-0.1089
112	Q	C	-0.8904
113	G	C	0.1885
114	T	C	0.6360
115	L	C	1.8862
116	V	C	0.0000
117	T	C	0.3603
118	V	C	0.0000
119	S	C	-0.7749
120	S	C	-1.0602