| Chain sequence(s) |
H: EVQLVESGGGLVQPKGSLKLSCAASGFTFNTYAMNWVRQAPGKGLEWVARIRSKYNNYATYYADSVKDRFTISRDDSQSILYLQMNNLKTEDTAMYYCVRHGNFGNSYVSWFAYWGQGTLVTVSS
L: QAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYANWVQEKPDHLFTGLIGGTNKRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNLWVFGGGTKLTVL input PDB |
| Selected Chain(s) | H,L |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:02)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:02)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with all chain(s) selected (00:00:02)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:02)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:02)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:05:14)
[INFO] Auto_mut: Residue number 12 from chain H and a score of 1.365 (leucine) selected for
automated muatation (00:05:20)
[INFO] Auto_mut: Residue number 127 from chain L and a score of 1.263 (leucine) selected for
automated muatation (00:05:20)
[INFO] Auto_mut: Residue number 3 from chain L and a score of 1.247 (valine) selected for
automated muatation (00:05:20)
[INFO] Auto_mut: Residue number 5 from chain H and a score of 1.169 (valine) selected for
automated muatation (00:05:20)
[INFO] Auto_mut: Residue number 123 from chain H and a score of 1.099 (leucine) selected for
automated muatation (00:05:20)
[INFO] Auto_mut: Residue number 112A from chain H and a score of 0.983 (tyrosine) selected
for automated muatation (00:05:20)
[INFO] Auto_mut: Mutating residue number 12 from chain H (leucine) into glutamic acid (00:05:20)
[INFO] Auto_mut: Mutating residue number 127 from chain L (leucine) into glutamic acid (00:05:20)
[INFO] Auto_mut: Mutating residue number 12 from chain H (leucine) into aspartic acid (00:05:20)
[INFO] Auto_mut: Mutating residue number 127 from chain L (leucine) into lysine (00:08:59)
[INFO] Auto_mut: Mutating residue number 12 from chain H (leucine) into arginine (00:09:08)
[INFO] Auto_mut: Mutating residue number 12 from chain H (leucine) into lysine (00:09:09)
[INFO] Auto_mut: Mutating residue number 127 from chain L (leucine) into aspartic acid (00:13:04)
[INFO] Auto_mut: Mutating residue number 3 from chain L (valine) into glutamic acid (00:13:07)
[INFO] Auto_mut: Mutating residue number 3 from chain L (valine) into aspartic acid (00:13:20)
[INFO] Auto_mut: Mutating residue number 127 from chain L (leucine) into arginine (00:16:03)
[INFO] Auto_mut: Mutating residue number 3 from chain L (valine) into lysine (00:16:16)
[INFO] Auto_mut: Mutating residue number 3 from chain L (valine) into arginine (00:16:30)
[INFO] Auto_mut: Mutating residue number 5 from chain H (valine) into glutamic acid (00:18:39)
[INFO] Auto_mut: Mutating residue number 5 from chain H (valine) into aspartic acid (00:19:07)
[INFO] Auto_mut: Mutating residue number 123 from chain H (leucine) into glutamic acid (00:19:09)
[INFO] Auto_mut: Mutating residue number 5 from chain H (valine) into lysine (00:21:01)
[INFO] Auto_mut: Mutating residue number 123 from chain H (leucine) into lysine (00:21:18)
[INFO] Auto_mut: Mutating residue number 5 from chain H (valine) into arginine (00:21:23)
[INFO] Auto_mut: Mutating residue number 123 from chain H (leucine) into aspartic acid (00:23:05)
[INFO] Auto_mut: Mutating residue number 112A from chain H (tyrosine) into glutamic acid (00:23:15)
[WARNING] Auto_mut: Mutation YE112AH could have failed (this can be ignored if the main program
reports the energy difference). Simulation log for that run should be
available at
/STORAGE/DATA/lcbio/aggreskan/97a8a4633305028/YE112AH/Aggrescan.error (00:23:17)
[INFO] Auto_mut: Mutating residue number 112A from chain H (tyrosine) into lysine (00:23:17)
[WARNING] Auto_mut: Mutation YK112AH could have failed (this can be ignored if the main program
reports the energy difference). Simulation log for that run should be
available at
/STORAGE/DATA/lcbio/aggreskan/97a8a4633305028/YK112AH/Aggrescan.error (00:23:19)
[INFO] Auto_mut: Mutating residue number 112A from chain H (tyrosine) into aspartic acid (00:23:19)
[WARNING] Auto_mut: Mutation YD112AH could have failed (this can be ignored if the main program
reports the energy difference). Simulation log for that run should be
available at
/STORAGE/DATA/lcbio/aggreskan/97a8a4633305028/YD112AH/Aggrescan.error (00:23:20)
[INFO] Auto_mut: Mutating residue number 112A from chain H (tyrosine) into arginine (00:23:20)
[WARNING] Auto_mut: Mutation YR112AH could have failed (this can be ignored if the main program
reports the energy difference). Simulation log for that run should be
available at
/STORAGE/DATA/lcbio/aggreskan/97a8a4633305028/YR112AH/Aggrescan.error (00:23:22)
[INFO] Auto_mut: Mutating residue number 123 from chain H (leucine) into arginine (00:24:28)
[INFO] Auto_mut: Effect of mutation residue number 12 from chain H (leucine) into glutamic
acid: Energy difference: 0.2060 kcal/mol, Difference in average score from
the base case: -0.0562 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 12 from chain H (leucine) into lysine:
Energy difference: 0.0744 kcal/mol, Difference in average score from the
base case: -0.0631 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 12 from chain H (leucine) into aspartic
acid: Energy difference: 0.5663 kcal/mol, Difference in average score from
the base case: -0.0568 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 12 from chain H (leucine) into arginine:
Energy difference: -0.2235 kcal/mol, Difference in average score from the
base case: -0.0606 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 127 from chain L (leucine) into glutamic
acid: Energy difference: 0.6039 kcal/mol, Difference in average score from
the base case: -0.0559 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 127 from chain L (leucine) into lysine:
Energy difference: 0.1404 kcal/mol, Difference in average score from the
base case: -0.0567 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 127 from chain L (leucine) into aspartic
acid: Energy difference: 1.1037 kcal/mol, Difference in average score from
the base case: -0.0556 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 127 from chain L (leucine) into arginine:
Energy difference: 0.0073 kcal/mol, Difference in average score from the
base case: -0.0562 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 3 from chain L (valine) into glutamic
acid: Energy difference: 0.0895 kcal/mol, Difference in average score from
the base case: -0.0586 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 3 from chain L (valine) into lysine:
Energy difference: -0.3072 kcal/mol, Difference in average score from the
base case: -0.0567 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 3 from chain L (valine) into aspartic
acid: Energy difference: 0.2917 kcal/mol, Difference in average score from
the base case: -0.0586 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 3 from chain L (valine) into arginine:
Energy difference: -0.2237 kcal/mol, Difference in average score from the
base case: -0.0610 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 5 from chain H (valine) into glutamic
acid: Energy difference: 0.2455 kcal/mol, Difference in average score from
the base case: -0.0540 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 5 from chain H (valine) into lysine:
Energy difference: -0.6329 kcal/mol, Difference in average score from the
base case: -0.0543 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 5 from chain H (valine) into aspartic
acid: Energy difference: 0.4866 kcal/mol, Difference in average score from
the base case: -0.0619 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 5 from chain H (valine) into arginine:
Energy difference: -1.3457 kcal/mol, Difference in average score from the
base case: -0.0400 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 123 from chain H (leucine) into glutamic
acid: Energy difference: 0.3771 kcal/mol, Difference in average score from
the base case: -0.0600 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 123 from chain H (leucine) into lysine:
Energy difference: -0.1971 kcal/mol, Difference in average score from the
base case: -0.0566 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 123 from chain H (leucine) into aspartic
acid: Energy difference: 1.1936 kcal/mol, Difference in average score from
the base case: -0.0520 (00:26:13)
[INFO] Auto_mut: Effect of mutation residue number 123 from chain H (leucine) into arginine:
Energy difference: -0.7424 kcal/mol, Difference in average score from the
base case: -0.0588 (00:26:14)
[INFO] Main: Simulation completed successfully. (00:26:20)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | E | H | -1.9147 | |
| 2 | V | H | -0.8633 | |
| 3 | Q | H | -0.7423 | |
| 4 | L | H | 0.0000 | |
| 5 | V | H | 1.1685 | |
| 6 | E | H | 0.3178 | |
| 7 | S | H | -0.2429 | |
| 8 | G | H | -0.6620 | |
| 9 | G | H | 0.0541 | |
| 11 | G | H | 0.7050 | |
| 12 | L | H | 1.3646 | |
| 13 | V | H | -0.1898 | |
| 14 | Q | H | -1.7171 | |
| 15 | P | H | -2.3972 | |
| 16 | K | H | -3.1392 | |
| 17 | G | H | -2.0926 | |
| 18 | S | H | -1.6852 | |
| 19 | L | H | -0.8165 | |
| 20 | K | H | -1.4093 | |
| 21 | L | H | 0.0000 | |
| 22 | S | H | -0.1539 | |
| 23 | C | H | 0.0000 | |
| 24 | A | H | 0.2866 | |
| 25 | A | H | 0.0000 | |
| 26 | S | H | -0.5744 | |
| 27 | G | H | -0.9895 | |
| 28 | F | H | -0.3307 | |
| 29 | T | H | -0.2722 | |
| 30 | F | H | 0.0000 | |
| 35 | N | H | -0.9520 | |
| 36 | T | H | -0.5056 | |
| 37 | Y | H | -0.3321 | |
| 38 | A | H | -0.7310 | |
| 39 | M | H | 0.0000 | |
| 40 | N | H | 0.0000 | |
| 41 | W | H | 0.0000 | |
| 42 | V | H | 0.0000 | |
| 43 | R | H | 0.0000 | |
| 44 | Q | H | 0.0000 | |
| 45 | A | H | -1.0441 | |
| 46 | P | H | -0.8780 | |
| 47 | G | H | -1.4371 | |
| 48 | K | H | -2.2543 | |
| 49 | G | H | -1.3786 | |
| 50 | L | H | 0.0000 | |
| 51 | E | H | -0.8764 | |
| 52 | W | H | 0.0000 | |
| 53 | V | H | 0.0000 | |
| 54 | A | H | 0.0000 | |
| 55 | R | H | -0.3391 | |
| 56 | I | H | 0.0000 | |
| 57 | R | H | -1.1388 | |
| 58 | S | H | 0.0000 | |
| 59 | K | H | -1.8034 | |
| 60 | Y | H | -0.1721 | |
| 61 | N | H | -1.0953 | |
| 62 | N | H | -1.6355 | |
| 63 | Y | H | -1.0126 | |
| 64 | A | H | -0.6594 | |
| 65 | T | H | -0.3496 | |
| 66 | Y | H | -0.3824 | |
| 67 | Y | H | -0.9781 | |
| 68 | A | H | 0.0000 | |
| 69 | D | H | -2.5517 | |
| 70 | S | H | -1.8094 | |
| 71 | V | H | 0.0000 | |
| 72 | K | H | -2.5849 | |
| 74 | D | H | -2.9068 | |
| 75 | R | H | -2.2789 | |
| 76 | F | H | 0.0000 | |
| 77 | T | H | -0.9296 | |
| 78 | I | H | 0.0000 | |
| 79 | S | H | -0.3282 | |
| 80 | R | H | -0.8505 | |
| 81 | D | H | -1.1455 | |
| 82 | D | H | -1.4102 | |
| 83 | S | H | -1.1538 | |
| 84 | Q | H | -1.5396 | |
| 85 | S | H | -0.8863 | |
| 86 | I | H | -0.2042 | |
| 87 | L | H | 0.0000 | |
| 88 | Y | H | -0.2937 | |
| 89 | L | H | 0.0000 | |
| 90 | Q | H | -1.0118 | |
| 91 | M | H | 0.0000 | |
| 92 | N | H | -2.3086 | |
| 93 | N | H | -3.0841 | |
| 94 | L | H | 0.0000 | |
| 95 | K | H | -2.9859 | |
| 96 | T | H | -2.0135 | |
| 97 | E | H | -2.3302 | |
| 98 | D | H | 0.0000 | |
| 99 | T | H | -0.4924 | |
| 100 | A | H | 0.0000 | |
| 101 | M | H | 0.4015 | |
| 102 | Y | H | 0.0000 | |
| 103 | Y | H | 0.0000 | |
| 104 | C | H | 0.0000 | |
| 105 | V | H | 0.0000 | |
| 106 | R | H | 0.0000 | |
| 107 | H | H | 0.0000 | |
| 108 | G | H | 0.1618 | |
| 109 | N | H | -0.2324 | |
| 110 | F | H | 0.5066 | |
| 111 | G | H | -0.5466 | |
| 111A | N | H | -1.0989 | |
| 112B | S | H | -0.0414 | |
| 112A | Y | H | 0.9834 | |
| 112 | V | H | 0.4033 | |
| 113 | S | H | 0.3760 | |
| 114 | W | H | 0.0000 | |
| 115 | F | H | 0.0000 | |
| 116 | A | H | 0.0000 | |
| 117 | Y | H | 0.4287 | |
| 118 | W | H | 0.0000 | |
| 119 | G | H | 0.0650 | |
| 120 | Q | H | -0.8495 | |
| 121 | G | H | -0.0077 | |
| 122 | T | H | 0.2875 | |
| 123 | L | H | 1.0994 | |
| 124 | V | H | 0.0000 | |
| 125 | T | H | 0.2176 | |
| 126 | V | H | 0.0000 | |
| 127 | S | H | -0.6575 | |
| 128 | S | H | -0.6640 | |
| 1 | Q | L | -0.9479 | |
| 2 | A | L | 0.2479 | |
| 3 | V | L | 1.2466 | |
| 4 | V | L | 0.0000 | |
| 5 | T | L | -0.3309 | |
| 6 | Q | L | -0.9514 | |
| 7 | E | L | -1.0062 | |
| 8 | S | L | -0.6461 | |
| 9 | A | L | -0.2952 | |
| 11 | L | L | 0.0119 | |
| 12 | T | L | 0.2004 | |
| 13 | T | L | 0.0000 | |
| 14 | S | L | -0.2505 | |
| 15 | P | L | -0.9167 | |
| 16 | G | L | -1.4282 | |
| 17 | E | L | -1.7863 | |
| 18 | T | L | -0.9423 | |
| 19 | V | L | -0.2660 | |
| 20 | T | L | 0.1452 | |
| 21 | L | L | 0.0000 | |
| 22 | T | L | 0.0000 | |
| 23 | C | L | 0.0000 | |
| 24 | R | L | -1.0469 | |
| 25 | S | L | 0.0000 | |
| 26 | S | L | -0.0906 | |
| 27 | T | L | -0.2422 | |
| 28 | G | L | -0.7142 | |
| 29 | A | L | -0.6296 | |
| 30 | V | L | 0.0000 | |
| 31 | T | L | -0.2209 | |
| 35 | T | L | -0.1771 | |
| 36 | S | L | -0.1712 | |
| 37 | N | L | 0.0057 | |
| 38 | Y | L | 0.2182 | |
| 39 | A | L | 0.0000 | |
| 40 | N | L | 0.0000 | |
| 41 | W | L | 0.0000 | |
| 42 | V | L | 0.0000 | |
| 43 | Q | L | 0.0629 | |
| 44 | E | L | 0.0000 | |
| 45 | K | L | -0.6103 | |
| 46 | P | L | -0.9731 | |
| 47 | D | L | -1.8915 | |
| 48 | H | L | -0.9882 | |
| 49 | L | L | 0.3002 | |
| 50 | F | L | 0.0000 | |
| 51 | T | L | 0.3381 | |
| 52 | G | L | 0.0000 | |
| 53 | L | L | 0.0000 | |
| 54 | I | L | 0.0000 | |
| 55 | G | L | 0.0000 | |
| 56 | G | L | 0.0000 | |
| 57 | T | L | 0.0000 | |
| 65 | N | L | -1.9797 | |
| 66 | K | L | -1.9826 | |
| 67 | R | L | -1.7426 | |
| 68 | A | L | 0.0000 | |
| 69 | P | L | -0.7518 | |
| 70 | G | L | -0.6302 | |
| 71 | V | L | -0.3779 | |
| 72 | P | L | -0.3683 | |
| 74 | A | L | -0.3075 | |
| 75 | R | L | -0.3967 | |
| 76 | F | L | 0.0000 | |
| 77 | S | L | -0.9254 | |
| 78 | G | L | 0.0000 | |
| 79 | S | L | -0.3575 | |
| 80 | L | L | 0.3555 | |
| 83 | I | L | 0.7591 | |
| 84 | G | L | -0.2724 | |
| 85 | D | L | -0.9146 | |
| 86 | K | L | -0.7020 | |
| 87 | A | L | 0.0000 | |
| 88 | A | L | 0.0000 | |
| 89 | L | L | 0.0000 | |
| 90 | T | L | -0.1152 | |
| 91 | I | L | 0.0000 | |
| 92 | T | L | -0.6682 | |
| 93 | G | L | -1.0706 | |
| 94 | A | L | 0.0000 | |
| 95 | Q | L | -1.4992 | |
| 96 | T | L | -1.1260 | |
| 97 | E | L | -2.1302 | |
| 98 | D | L | 0.0000 | |
| 99 | E | L | -1.2066 | |
| 100 | A | L | 0.0000 | |
| 101 | I | L | 0.1120 | |
| 102 | Y | L | 0.0000 | |
| 103 | F | L | 0.0000 | |
| 104 | C | L | 0.0000 | |
| 105 | A | L | 0.0000 | |
| 106 | L | L | 0.0000 | |
| 107 | W | L | 0.0131 | |
| 108 | Y | L | -0.3305 | |
| 109 | S | L | -0.7113 | |
| 114 | N | L | -1.1638 | |
| 115 | L | L | -0.6456 | |
| 116 | W | L | 0.0000 | |
| 117 | V | L | 0.2926 | |
| 118 | F | L | 0.0000 | |
| 119 | G | L | 0.0000 | |
| 120 | G | L | -0.8174 | |
| 121 | G | L | -0.6784 | |
| 122 | T | L | 0.0000 | |
| 123 | K | L | -0.5616 | |
| 124 | L | L | 0.0000 | |
| 125 | T | L | 0.1049 | |
| 126 | V | L | 0.0000 | |
| 127 | L | L | 1.2630 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| VR5H | -1.3457 | -0.04 | View | CSV | PDB |
| LR123H | -0.7424 | -0.0588 | View | CSV | PDB |
| VK5H | -0.6329 | -0.0543 | View | CSV | PDB |
| VK3L | -0.3072 | -0.0567 | View | CSV | PDB |
| VR3L | -0.2237 | -0.061 | View | CSV | PDB |
| LR12H | -0.2235 | -0.0606 | View | CSV | PDB |
| LK123H | -0.1971 | -0.0566 | View | CSV | PDB |
| LR127L | 0.0073 | -0.0562 | View | CSV | PDB |
| LK12H | 0.0744 | -0.0631 | View | CSV | PDB |
| LK127L | 0.1404 | -0.0567 | View | CSV | PDB |