Project name: s0v15ee

Status: done

Started: 2026-02-28 08:00:58
Settings
Chain sequence(s) A: EEEWFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGSGSGSEIAALEKEIAALEKEIAALERKIAALKKKIAALKKKIAALKKKIAALKKKGSGSGSENLYFQSGSGSGSEWFWAEWCGPCKMIAPILDEIADEYQGKLTVAKLNIDQNPGSGSGSEIAALEKEIAALEKEIAALERKIAALKAAIAAAVKKGSGSGSYPYDVPDYA
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:12)
Show buried residues

Minimal score value
-3.9081
Maximal score value
1.8967
Average score
-1.5561
Total score value
-333.0003

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -3.2586
2 E A -3.5138
3 E A -2.9437
4 W A -1.0170
5 F A 0.5215
6 W A -0.2460
7 A A 0.0000
8 E A -1.6720
9 W A -0.1282
10 C A -0.3798
11 G A -0.6747
12 P A -0.1914
13 C A -0.2588
14 K A -1.1626
15 M A 0.5854
16 I A 0.5348
17 A A -0.4420
18 P A -0.6055
19 I A -0.1624
20 L A 0.0000
21 D A -2.7656
22 E A -3.1635
23 I A -1.7890
24 A A -2.5568
25 D A -3.9081
26 E A -3.4658
27 Y A -2.2303
28 Q A -2.8058
29 G A -2.0927
30 K A -2.8304
31 L A -2.2671
32 T A -1.9202
33 V A -1.4823
34 A A -1.3601
35 K A -1.0335
36 L A -0.3594
37 N A -1.0651
38 I A -1.0364
39 D A -1.8151
40 Q A -2.1588
41 N A -2.2796
42 P A -1.7213
43 G A -1.4523
44 S A -1.1833
45 G A -1.1879
46 S A -1.1455
47 G A -1.0003
48 S A -1.1061
49 E A -1.7563
50 I A -0.5356
51 A A -1.0798
52 A A -1.1884
53 L A -0.5263
54 E A -2.1492
55 K A -2.8130
56 E A -2.3856
57 I A -1.4686
58 A A -2.1952
59 A A -2.2765
60 L A -2.1926
61 E A -2.8772
62 K A -3.3689
63 E A -3.0321
64 I A -2.1350
65 A A -2.5501
66 A A -2.5405
67 L A -2.6302
68 E A -3.4799
69 R A -3.5516
70 K A -3.3155
71 I A 0.0000
72 A A -2.5473
73 A A -2.3759
74 L A -2.5591
75 K A -3.0049
76 K A -3.0313
77 K A -2.4270
78 I A -2.5455
79 A A -2.2284
80 A A -2.1737
81 L A -2.4399
82 K A -3.1736
83 K A -3.1906
84 K A -2.8823
85 I A -2.8748
86 A A -2.4251
87 A A -2.3587
88 L A 0.0000
89 K A -3.3420
90 K A -3.2736
91 K A -2.8857
92 I A 0.0000
93 A A -2.5854
94 A A -2.6101
95 L A -2.8220
96 K A -3.5551
97 K A -3.7109
98 K A -3.5085
99 G A -2.9033
100 S A -2.6087
101 G A -2.5340
102 S A -2.0449
103 G A -1.5830
104 S A -1.3964
105 E A -2.1715
106 N A -0.9610
107 L A 1.2982
108 Y A 1.6911
109 F A 1.8967
110 Q A -0.0302
111 S A -0.3956
112 G A -0.9598
113 S A -1.0100
114 G A -1.3895
115 S A -1.2983
116 G A -1.5198
117 S A -1.1745
118 E A -1.3663
119 W A 0.1039
120 F A 1.6921
121 W A 0.3327
122 A A 0.0000
123 E A -1.8044
124 W A -0.1323
125 C A -0.3886
126 G A -0.7549
127 P A -0.5065
128 C A -0.2484
129 K A -1.2902
130 M A 0.4412
131 I A 0.2855
132 A A -0.4411
133 P A -0.4769
134 I A 0.1074
135 L A -0.7410
136 D A -2.6003
137 E A -2.9694
138 I A -1.5690
139 A A -2.3800
140 D A -3.7943
141 E A -3.5078
142 Y A -2.3689
143 Q A -2.8587
144 G A -2.1388
145 K A -2.5955
146 L A -1.5225
147 T A -1.3166
148 V A -1.1676
149 A A -0.7524
150 K A -0.9338
151 L A -0.1739
152 N A 0.0000
153 I A -0.5145
154 D A -1.8373
155 Q A -2.1811
156 N A -1.9571
157 P A -1.8357
158 G A -1.4646
159 S A -1.1645
160 G A -1.2786
161 S A -1.5498
162 G A -1.4777
163 S A -1.4459
164 E A -1.6861
165 I A -1.8675
166 A A -1.5653
167 A A -1.7886
168 L A 0.0000
169 E A -3.2987
170 K A -3.3673
171 E A -3.1537
172 I A -2.9797
173 A A -2.4934
174 A A -2.3647
175 L A -2.5834
176 E A -3.2562
177 K A -3.1983
178 E A -2.4403
179 I A -2.6735
180 A A -2.3968
181 A A -2.3325
182 L A -2.5834
183 E A -3.3047
184 R A -3.2818
185 K A -2.9034
186 I A 0.0000
187 A A -1.8963
188 A A -1.5001
189 L A 0.0000
190 K A -1.9222
191 A A -0.5105
192 A A -0.1462
193 I A -0.7308
194 A A -0.2753
195 A A -0.6204
196 A A 0.0000
197 V A 0.1913
198 K A -1.9206
199 K A -2.3087
200 G A -1.3967
201 S A -1.7783
202 G A -1.9671
203 S A -1.1145
204 G A -0.9133
205 S A 0.1121
206 Y A 1.2089
207 P A 0.6878
208 Y A 1.2537
209 D A -0.4424
210 V A 1.1107
211 P A -0.0461
212 D A -0.9775
213 Y A 0.7310
214 A A 0.1057
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018