Project name: query_structure

Status: done

Started: 2026-03-16 22:48:15
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVVYYDITYGETGGSYWHYQTFKVPGSKSTATISGLKPGVDYTITVYAYYSSYRYWSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:39)
Show buried residues

Minimal score value
-2.6274
Maximal score value
1.955
Average score
-0.2835
Total score value
-26.0801

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.8182
2 S A 0.8590
3 S A 0.9629
4 V A 0.4776
5 P A 0.0000
6 T A -1.6199
7 K A -2.6102
8 L A 0.0000
9 E A -1.9009
10 V A 0.1277
11 V A 1.5546
12 A A 0.9083
13 A A 0.3272
14 T A -0.3356
15 P A -1.1138
16 T A -0.9882
17 S A -0.5189
18 L A 0.0000
19 L A 0.7723
20 I A 0.0000
21 S A -0.9557
22 W A 0.0000
23 D A -2.6274
24 A A -1.2324
25 P A 0.0730
26 A A 0.5182
27 V A 1.1291
28 T A 0.8569
29 V A 1.1316
30 V A 1.9550
31 Y A 0.2408
32 Y A 0.0000
33 D A -0.8612
34 I A 0.0000
35 T A 0.0000
36 Y A -0.4614
37 G A 0.0000
38 E A -1.8720
39 T A -1.1867
40 G A -0.8316
41 G A -0.6995
42 S A 0.2096
43 Y A 1.1242
44 W A 1.0880
45 H A -0.4494
46 Y A -0.3347
47 Q A -0.9587
48 T A -0.8390
49 F A -0.6202
50 K A -1.5333
51 V A 0.0000
52 P A -0.6919
53 G A -0.1113
54 S A -0.7815
55 K A -1.8693
56 S A -1.4013
57 T A -0.7570
58 A A 0.0000
59 T A 0.2484
60 I A 0.0000
61 S A -0.6551
62 G A -1.0233
63 L A 0.0000
64 K A -2.3907
65 P A -1.6376
66 G A -1.4324
67 V A -1.4564
68 D A -2.1405
69 Y A 0.0000
70 T A -1.0369
71 I A 0.0000
72 T A 0.0000
73 V A 0.0000
74 Y A 0.0000
75 A A 0.0000
76 Y A 1.1514
77 Y A 1.6099
78 S A 0.9771
79 S A 0.5613
80 Y A 1.1611
81 R A -0.0826
82 Y A 0.6448
83 W A 1.0965
84 S A 0.4944
85 P A 0.2244
86 I A 0.1172
87 S A -0.4886
88 I A -0.7121
89 N A -1.7559
90 Y A -1.4915
91 R A -2.5428
92 T A -1.4914
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018