Project name: 97d5121030ee03b

Status: done

Started: 2026-06-27 09:19:12
Settings
Chain sequence(s) A: MSHHHHHHSGNRKKRHGEFFKWFAEFVMSRDVSPKTKKELSQVMQELAELFTSGKFTVDKYMELFAKMSSLTPQFVEEAKGEPNWTEKMMKLVKRTIRSMYDAIYIMNRKEAYEAMIVFMVQMVKSEDLPNLFKEAMRNDSEIDDLHYHIHWNMPRKTDHKMMNRAEEKAEKEGLSPEKVIQAVRLFEWMNS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:06:47)
[INFO]       Main:     Simulation completed successfully.                                          (00:06:48)
Show buried residues

Minimal score value
-4.8699
Maximal score value
2.6228
Average score
-1.3519
Total score value
-259.5708

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.2808
2 S A -1.0584
3 H A -2.2166
4 H A -2.6337
5 H A -2.7810
6 H A -3.1429
7 H A -3.1954
8 H A -2.9977
9 S A -2.4999
10 G A -2.6605
11 N A -3.2541
12 R A -2.6230
13 K A -2.6551
14 K A -3.7082
15 R A -3.6081
16 H A 0.0000
17 G A 0.0000
18 E A -3.3388
19 F A -2.0767
20 F A 0.0000
21 K A -2.5368
22 W A -1.3745
23 F A 0.0000
24 A A -1.7317
25 E A -1.7201
26 F A -0.7045
27 V A 0.0000
28 M A -0.7003
29 S A -0.7665
30 R A -1.2507
31 D A -2.1380
32 V A -1.9400
33 S A -1.5998
34 P A -1.9517
35 K A -2.7639
36 T A -2.1082
37 K A -2.2400
38 K A -3.1411
39 E A -2.8747
40 L A 0.0000
41 S A 0.0000
42 Q A -2.3324
43 V A 0.0000
44 M A 0.0000
45 Q A -2.5121
46 E A -2.5904
47 L A 0.0000
48 A A 0.0000
49 E A -3.0625
50 L A 0.0000
51 F A 0.0000
52 T A -2.2169
53 S A -1.4438
54 G A -1.8053
55 K A -2.2221
56 F A -1.3355
57 T A -1.0276
58 V A -1.1172
59 D A -2.4860
60 K A -2.5295
61 Y A 0.0000
62 M A -1.8391
63 E A -2.7811
64 L A 0.0000
65 F A 0.0000
66 A A -1.1146
67 K A -1.7256
68 M A 0.0000
69 S A 0.0000
70 S A -0.5507
71 L A -0.6048
72 T A 0.0000
73 P A 0.0000
74 Q A -1.8080
75 F A 0.0000
76 V A 0.0000
77 E A -2.8426
78 E A -2.1990
79 A A 0.0000
80 K A -2.4317
81 G A -1.8725
82 E A -1.6471
83 P A -1.3458
84 N A -1.9638
85 W A -1.6034
86 T A -1.4651
87 E A -1.9977
88 K A -1.7832
89 M A 0.0000
90 M A -1.7166
91 K A -2.5278
92 L A 0.0000
93 V A 0.0000
94 K A -2.1576
95 R A -2.1423
96 T A 0.0000
97 I A 0.0000
98 R A -1.3565
99 S A 0.0000
100 M A 0.0000
101 Y A 0.0000
102 D A 0.0000
103 A A 0.0000
104 I A -0.1659
105 Y A -0.5358
106 I A -0.4447
107 M A 0.0000
108 N A -2.4220
109 R A -3.0047
110 K A -2.8272
111 E A -1.9437
112 A A 0.0000
113 Y A 0.0172
114 E A -0.7621
115 A A 0.0000
116 M A 1.2530
117 I A 2.1663
118 V A 1.6236
119 F A 0.0000
120 M A 2.0700
121 V A 2.6228
122 Q A 1.1889
123 M A 0.0000
124 V A 0.9072
125 K A -1.1386
126 S A 0.0000
127 E A -2.5072
128 D A -2.0484
129 L A 0.0000
130 P A -1.3693
131 N A -2.3456
132 L A 0.0000
133 F A 0.0000
134 K A -2.9242
135 E A -3.4822
136 A A 0.0000
137 M A -2.4190
138 R A -3.3141
139 N A -3.1566
140 D A -2.5429
141 S A -2.3053
142 E A -2.8216
143 I A 0.0000
144 D A -2.4027
145 D A -2.3710
146 L A -1.3297
147 H A -1.1901
148 Y A -0.9315
149 H A -0.9548
150 I A -0.5201
151 H A -0.9818
152 W A -0.6988
153 N A -1.3095
154 M A -1.2423
155 P A -2.0630
156 R A -3.3814
157 K A -3.2430
158 T A -2.2630
159 D A -2.5364
160 H A -2.9106
161 K A -3.2792
162 M A -2.2800
163 M A 0.0000
164 N A -2.9066
165 R A -3.8828
166 A A -2.6690
167 E A -3.4886
168 E A -4.7687
169 K A -4.8699
170 A A 0.0000
171 E A -4.7661
172 K A -4.6108
173 E A -4.0250
174 G A -2.7016
175 L A -2.1173
176 S A -1.6083
177 P A -1.6877
178 E A -2.2905
179 K A -2.2969
180 V A 0.0000
181 I A -0.4629
182 Q A -0.8460
183 A A -0.4184
184 V A 0.0000
185 R A 0.1531
186 L A 1.2147
187 F A 0.9908
188 E A 0.0000
189 W A 0.7291
190 M A 0.9595
191 N A -0.5082
192 S A -0.3020
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018