Project name: query_structure

Status: done

Started: 2026-03-16 23:09:42
Settings
Chain sequence(s) A: ESCVWIPCISAVVGCSCKSKVCYKNGTLPCG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:43)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:45)
Show buried residues

Minimal score value
-1.4932
Maximal score value
2.9927
Average score
0.3693
Total score value
11.4491

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -0.1705
2 S A 0.1912
3 C A 0.8087
4 V A 1.0110
5 W A 1.9162
6 I A 2.2141
7 P A 1.3345
8 C A 0.0000
9 I A 2.7150
10 S A 1.8936
11 A A 1.9610
12 V A 2.9927
13 V A 2.6288
14 G A 0.7804
15 C A 0.0000
16 S A -0.1273
17 C A -0.3128
18 K A -1.4859
19 S A -1.1796
20 K A -1.2598
21 V A -0.6298
22 C A 0.0000
23 Y A -0.5953
24 K A -0.7525
25 N A -1.4932
26 G A -1.0072
27 T A -0.1928
28 L A 0.7491
29 P A -0.0254
30 C A 0.0000
31 G A -0.5151
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018