Project name: query_structure

Status: done

Started: 2026-03-16 21:22:21
Settings
Chain sequence(s) A: MIPRGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVLAHRQYPPGPHSTNYYIKVRAGDNKYMHLKVFNGPYHFHHYYKHADRVLTGYQVDKNKDDELTGF
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:53)
Show buried residues

Minimal score value
-4.2485
Maximal score value
1.8134
Average score
-1.1284
Total score value
-126.3807

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.7038
2 I A 1.8134
3 P A 0.1829
4 R A -1.2587
5 G A -1.1114
6 L A -0.8071
7 S A -1.2176
8 E A -2.1231
9 A A -1.6836
10 K A -1.5424
11 P A -0.9163
12 A A -0.9041
13 T A -1.2697
14 P A -1.7372
15 E A -2.8345
16 I A 0.0000
17 Q A -2.5988
18 E A -3.6103
19 I A 0.0000
20 V A 0.0000
21 D A -3.4490
22 K A -2.6367
23 V A 0.0000
24 K A -2.1992
25 P A -1.8984
26 Q A -1.9231
27 L A 0.0000
28 E A -2.9637
29 E A -3.6513
30 K A -3.1088
31 T A -2.4456
32 N A -3.3313
33 E A -3.1777
34 T A -1.8855
35 Y A -1.2926
36 G A -1.4210
37 K A -2.5673
38 L A 0.0000
39 E A -2.1466
40 A A -1.5270
41 V A -0.6279
42 Q A -1.2045
43 Y A 0.0000
44 K A 0.0000
45 T A -0.4713
46 Q A -0.4442
47 V A -0.0336
48 L A -0.3564
49 A A -1.2239
50 H A -1.8634
51 R A -2.5332
52 Q A -1.7929
53 Y A -0.0246
54 P A -0.2650
55 P A -0.9846
56 G A -0.8846
57 P A -0.9381
58 H A -1.3189
59 S A -0.4329
60 T A 0.0000
61 N A 0.0000
62 Y A 0.1551
63 Y A 0.0000
64 I A 0.0000
65 K A 0.0000
66 V A 0.0000
67 R A -2.7755
68 A A -2.1724
69 G A -2.5129
70 D A -2.9684
71 N A -3.7889
72 K A -3.5456
73 Y A 0.0000
74 M A 0.0000
75 H A 0.0000
76 L A 0.0000
77 K A 0.0038
78 V A 0.0000
79 F A 0.0238
80 N A -0.5181
81 G A 0.0000
82 P A -0.3794
83 Y A 0.6755
84 H A 0.3186
85 F A 1.1529
86 H A -0.0993
87 H A -0.5264
88 Y A 0.5511
89 Y A 0.0049
90 K A -1.8492
91 H A -1.5822
92 A A -1.6148
93 D A -2.2086
94 R A -1.1951
95 V A -0.2961
96 L A 0.0000
97 T A 0.1574
98 G A 0.0153
99 Y A 0.3067
100 Q A -0.1889
101 V A -0.3541
102 D A -2.3010
103 K A -3.1795
104 N A -4.2485
105 K A -4.2379
106 D A -3.8041
107 D A -3.4957
108 E A -3.1221
109 L A 0.0000
110 T A -0.5323
111 G A -0.1228
112 F A 0.8135
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018