Project name: 98cd2541c2dd3a1

Chain sequence(s)	A: SGLQQYLKATTNCQVTNAQIQALATKITSGKTSAYDKAVAIFNWVRDNISYSFYYNTKRGAVGTLNAKSGNCVDTTHLLIALSRAAGIPARYRHGTCKFTSGNTYGHVWAQIWVDGKWYAADATSSRNSFGVINNWNTATYTLKGTYASLSF
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:07)

• Minimal score value: -2.6848
• Maximal score value: 2.3518
• Average score: -0.5479
• Total score value: -83.2835

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	S	A	-0.8286
2	G	A	-0.9121
3	L	A	-0.8316
4	Q	A	-1.7635
5	Q	A	-1.8960
6	Y	A	-1.0027
7	L	A	-0.9798
8	K	A	-2.0174
9	A	A	-1.0439
10	T	A	-0.6978
11	T	A	-0.3057
12	N	A	-0.7576
13	C	A	0.0000
14	Q	A	-0.8399
15	V	A	0.0000
16	T	A	-0.7929
17	N	A	-0.8087
18	A	A	-0.6770
19	Q	A	-1.1085
20	I	A	0.0000
21	Q	A	-1.1031
22	A	A	-0.8891
23	L	A	-0.7310
24	A	A	0.0000
25	T	A	-1.2074
26	K	A	-1.7665
27	I	A	-0.8184
28	T	A	-1.2266
29	S	A	-1.2370
30	G	A	-1.3756
31	K	A	-1.5274
32	T	A	-0.9365
33	S	A	-1.0356
34	A	A	-0.8196
35	Y	A	-0.6890
36	D	A	-1.6297
37	K	A	-1.1456
38	A	A	0.0000
39	V	A	-0.1562
40	A	A	-0.3990
41	I	A	0.0000
42	F	A	0.0000
43	N	A	-0.9133
44	W	A	-0.7373
45	V	A	0.0000
46	R	A	-1.6715
47	D	A	-2.4295
48	N	A	-1.9965
49	I	A	0.0000
50	S	A	-0.5495
51	Y	A	0.8600
52	S	A	1.2888
53	F	A	2.3518
54	Y	A	1.3979
55	Y	A	1.0597
56	N	A	-0.6528
57	T	A	-1.3521
58	K	A	-2.4406
59	R	A	-2.6848
60	G	A	0.0000
61	A	A	0.0000
62	V	A	-0.9103
63	G	A	-1.5304
64	T	A	0.0000
65	L	A	0.0000
66	N	A	-1.8988
67	A	A	-1.4502
68	K	A	-1.8083
69	S	A	-0.8368
70	G	A	0.0000
71	N	A	0.0000
72	C	A	0.0000
73	V	A	0.0000
74	D	A	0.0000
75	T	A	0.0000
76	T	A	0.0000
77	H	A	0.0000
78	L	A	0.0000
79	L	A	0.0000
80	I	A	0.0000
81	A	A	0.0000
82	L	A	0.0000
83	S	A	0.0000
84	R	A	0.0000
85	A	A	-0.5256
86	A	A	-0.2674
87	G	A	-0.5460
88	I	A	0.0000
89	P	A	-0.3787
90	A	A	0.0000
91	R	A	-0.2138
92	Y	A	0.0000
93	R	A	-0.3535
94	H	A	0.0000
95	G	A	0.0000
96	T	A	-0.2850
97	C	A	0.0000
98	K	A	-1.7415
99	F	A	-1.1918
100	T	A	-1.0757
101	S	A	-0.9291
102	G	A	-1.3155
103	N	A	-1.4625
104	T	A	-0.8679
105	Y	A	0.0107
106	G	A	-0.3191
107	H	A	0.0000
108	V	A	0.0000
109	W	A	0.0000
110	A	A	0.0000
111	Q	A	-0.2342
112	I	A	0.0000
113	W	A	-0.5196
114	V	A	0.0000
115	D	A	-2.2656
116	G	A	-2.0060
117	K	A	-2.1497
118	W	A	-0.8127
119	Y	A	-0.0639
120	A	A	0.4073
121	A	A	0.0000
122	D	A	0.0000
123	A	A	0.0000
124	T	A	-0.4138
125	S	A	-1.0261
126	S	A	-1.6544
127	R	A	-1.8250
128	N	A	0.0000
129	S	A	-0.1793
130	F	A	0.0000
131	G	A	0.7103
132	V	A	1.1284
133	I	A	0.0160
134	N	A	-1.0131
135	N	A	-1.0740
136	W	A	0.0000
137	N	A	-1.4249
138	T	A	-0.5294
139	A	A	-0.3891
140	T	A	-0.3317
141	Y	A	-0.1757
142	T	A	-0.0780
143	L	A	0.1116
144	K	A	-1.2794
145	G	A	-0.5756
146	T	A	-0.2096
147	Y	A	-0.0944
148	A	A	-0.4729
149	S	A	-0.4137
150	L	A	0.0000
151	S	A	-0.1234
152	F	A	0.0020