Project name: query_structure

Status: done

Started: 2026-03-16 22:47:20
Settings
Chain sequence(s) A: VSSVPTKLEVVAATPTSLLISWDAPAVTVSYYVITYGETGGHYWHWQTFTVPGSKSTATISGLKPGVDYTITVYAKSYMYGPPSYKSSPISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:37)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:37)
Show buried residues

Minimal score value
-2.4911
Maximal score value
1.7694
Average score
-0.2769
Total score value
-26.5827

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 V A 1.7694
2 S A 0.7435
3 S A 0.3851
4 V A 0.0134
5 P A 0.0000
6 T A -1.3403
7 K A -2.3452
8 L A 0.0000
9 E A -1.8180
10 V A 0.0920
11 V A 1.5226
12 A A 0.8824
13 A A 0.2929
14 T A -0.5286
15 P A -1.1222
16 T A -0.9941
17 S A -0.5323
18 L A 0.0000
19 L A 0.7211
20 I A 0.0000
21 S A -0.7810
22 W A 0.0000
23 D A -1.7463
24 A A -0.8176
25 P A 0.1978
26 A A 0.5083
27 V A 0.6568
28 T A 0.3932
29 V A 0.3534
30 S A 0.4143
31 Y A 0.4443
32 Y A 0.0000
33 V A 0.1797
34 I A 0.0000
35 T A -0.0284
36 Y A 0.0000
37 G A 0.0000
38 E A -1.4524
39 T A -1.0188
40 G A -0.7924
41 G A -0.7292
42 H A -0.4611
43 Y A 0.8567
44 W A 0.8957
45 H A -0.5215
46 W A -0.2551
47 Q A -0.7558
48 T A -0.3553
49 F A 0.2533
50 T A 0.3513
51 V A 0.0000
52 P A -0.4953
53 G A -0.4949
54 S A -0.9894
55 K A -1.8784
56 S A -1.1376
57 T A -0.6582
58 A A 0.0000
59 T A 0.2295
60 I A 0.0000
61 S A -0.6579
62 G A -1.0288
63 L A 0.0000
64 K A -2.3383
65 P A -1.6466
66 G A -1.4343
67 V A -1.3396
68 D A -1.9871
69 Y A 0.0000
70 T A -0.8982
71 I A 0.0000
72 T A 0.0000
73 V A 0.0000
74 Y A -0.1507
75 A A 0.0000
76 K A 0.0238
77 S A 0.0000
78 Y A 1.7662
79 M A 1.7273
80 Y A 1.7671
81 G A 0.6952
82 P A 0.2302
83 P A 0.0237
84 S A 0.4196
85 Y A 0.7112
86 K A -1.0734
87 S A -0.5581
88 S A -0.4135
89 P A -0.2902
90 I A 0.0245
91 S A -0.3960
92 I A -0.7338
93 N A -1.7130
94 Y A -1.4261
95 R A -2.4911
96 T A -1.5021
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018