Project name: query_structure

Status: done

Started: 2026-03-16 20:07:25
Settings
Chain sequence(s) A: EAMHSFCAFKAADDGPCRAAHPRWFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:39)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:39)
Show buried residues

Minimal score value
-3.4034
Maximal score value
1.0973
Average score
-1.1739
Total score value
-71.6105

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -1.9359
2 A A -0.8942
3 M A -0.4992
4 H A -0.2582
5 S A 0.2180
6 F A 0.4795
7 C A 0.0000
8 A A 0.4469
9 F A 0.4735
10 K A -0.6107
11 A A -0.8451
12 A A -1.2105
13 D A -1.9276
14 D A -2.4160
15 G A -1.9347
16 P A -1.3897
17 C A -1.2316
18 R A -1.8079
19 A A -0.9082
20 A A -0.4040
21 H A -0.7467
22 P A -0.8590
23 R A -1.3977
24 W A -1.7911
25 F A 0.0000
26 F A 0.0000
27 N A -0.7067
28 I A 0.2874
29 F A 1.0973
30 T A -0.3393
31 R A -1.7234
32 Q A -2.1655
33 C A -2.1034
34 E A -1.8916
35 E A -2.0012
36 F A -0.6432
37 I A 0.2615
38 Y A 0.0000
39 G A 0.0000
40 G A -1.0422
41 C A -1.3169
42 E A -2.3764
43 G A -2.1960
44 N A 0.0000
45 Q A -1.3442
46 N A 0.0000
47 R A -1.6228
48 F A 0.0000
49 E A -2.6935
50 S A -2.3683
51 L A -2.2313
52 E A -3.2163
53 E A -3.1020
54 C A 0.0000
55 K A -3.4034
56 K A -3.3789
57 M A -1.8104
58 C A 0.0000
59 T A -2.6735
60 R A -2.7632
61 D A -2.6930
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018