Project name: orf_duf

Status: done

Started: 2026-03-22 15:14:05
Settings
Chain sequence(s) A: QPQPQQTQRKMLLDVTTGQYYLVDTPVQPMTRRLFDPETGQYVDVPMTSQQQPVAPM
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:34)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:34)
Show buried residues

Minimal score value
-3.1183
Maximal score value
2.3262
Average score
-0.5719
Total score value
-32.5972

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1596 Q A -1.6608
1597 P A -1.6518
1598 Q A -2.2344
1599 P A -1.9452
1600 Q A -2.4366
1601 Q A -2.6520
1602 T A -2.5022
1603 Q A -3.1183
1604 R A -3.0639
1605 K A -1.8631
1606 M A 1.2328
1607 L A 1.7872
1608 L A 2.1662
1609 D A 0.9340
1610 V A 1.6398
1611 T A 0.4510
1612 T A 0.0391
1613 G A 0.0173
1614 Q A -0.0586
1615 Y A 2.1528
1616 Y A 2.3262
1617 L A 2.0069
1618 V A 0.0356
1619 D A -2.1431
1620 T A -2.0680
1621 P A -1.6343
1622 V A -0.7686
1623 Q A -1.0097
1624 P A -0.2071
1625 M A 0.2696
1626 T A -1.0331
1627 R A -1.8392
1628 R A -2.0725
1629 L A 0.2023
1630 F A 1.1459
1631 D A -0.2964
1632 P A -1.0618
1633 E A -2.1899
1634 T A -1.2065
1635 G A -1.0103
1636 Q A -0.8581
1637 Y A 0.7271
1638 V A 0.2419
1639 D A -1.6287
1640 V A -0.5879
1641 P A -0.5592
1642 M A -0.2125
1643 T A -0.4569
1644 S A -1.1235
1645 Q A -2.2501
1646 Q A -2.2639
1647 Q A -1.7704
1648 P A -0.4810
1649 V A 1.2394
1650 A A 0.8541
1651 P A 0.6861
1652 M A 1.1671
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018