Project name: 1cyv

Chain sequence(s)	A: MIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYLHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:06)

• Minimal score value: -3.9923
• Maximal score value: 2.3681
• Average score: -0.7507
• Total score value: -73.5732

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	1.3891
2	I	A	1.2566
3	P	A	1.0113
4	G	A	0.0000
5	G	A	0.1101
6	L	A	0.5137
7	S	A	-0.3737
8	E	A	-1.2084
9	A	A	-0.9518
10	K	A	-1.6503
11	P	A	-0.7920
12	A	A	0.0000
13	T	A	0.0000
14	P	A	-1.6901
15	E	A	-2.6857
16	I	A	0.0000
17	Q	A	-2.5654
18	E	A	-3.2506
19	I	A	-1.7867
20	V	A	0.0000
21	D	A	-3.5371
22	K	A	-2.2408
23	V	A	0.2816
24	K	A	0.0000
25	P	A	-2.3138
26	Q	A	-2.5171
27	L	A	-2.0934
28	E	A	-3.1228
29	E	A	-3.8868
30	K	A	-3.5248
31	T	A	-2.9699
32	N	A	-2.9253
33	E	A	-1.9617
34	T	A	-0.2879
35	Y	A	0.3782
36	G	A	-0.5340
37	K	A	-1.4923
38	L	A	-2.0618
39	E	A	-1.8231
40	A	A	0.0000
41	V	A	0.0000
42	Q	A	0.0000
43	Y	A	-0.6549
44	K	A	-0.7725
45	T	A	-0.1739
46	Q	A	0.2872
47	V	A	2.0922
48	V	A	2.3681
49	A	A	0.8111
50	G	A	0.2752
51	T	A	1.0846
52	N	A	1.1766
53	Y	A	0.8810
54	Y	A	0.6003
55	I	A	0.0000
56	K	A	0.0000
57	V	A	0.0000
58	R	A	-1.0608
59	A	A	0.0000
60	G	A	0.0000
61	D	A	-2.8730
62	N	A	-3.3978
63	K	A	-3.2553
64	Y	A	-2.2128
65	L	A	0.0000
66	H	A	0.0000
67	L	A	0.0000
68	K	A	0.0000
69	V	A	1.1320
70	F	A	0.0000
71	K	A	-0.1916
72	S	A	-0.3079
73	L	A	-0.9665
74	P	A	-0.8355
75	G	A	-1.5965
76	Q	A	-2.5910
77	N	A	-3.0161
78	E	A	-3.2608
79	D	A	-2.4978
80	L	A	-0.1934
81	V	A	1.1587
82	L	A	1.8635
83	T	A	1.1179
84	G	A	1.1740
85	Y	A	1.6373
86	Q	A	0.4668
87	V	A	0.3491
88	D	A	0.0000
89	K	A	-3.2948
90	N	A	-3.9923
91	K	A	-3.4998
92	D	A	-2.2069
93	D	A	-2.9416
94	E	A	-1.5469
95	L	A	0.9213
96	T	A	0.8951
97	G	A	1.1627
98	F	A	1.6192