Project name: query_structure

Status: done

Started: 2026-03-17 00:44:29
Settings
Chain sequence(s) A: QVQLVESGGGLVQAGGSLRLSCAASGFPVNFQEMHWYRQAPGKEREWVAAIYSNGQHTKYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNVKDYGDWFEWYDYWGQGTQVTVS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:20)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:21)
Show buried residues

Minimal score value
-3.4307
Maximal score value
1.3823
Average score
-0.7826
Total score value
-93.9153

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.3566
2 V A -0.6814
3 Q A -1.1702
4 L A 0.0000
5 V A 0.3624
6 E A 0.0000
7 S A -0.6032
8 G A -1.0378
9 G A -0.8069
10 G A -0.0965
11 L A 0.9396
12 V A 0.0000
13 Q A -1.2986
14 A A -1.3982
15 G A -1.3031
16 G A -0.8813
17 S A -1.2062
18 L A -0.9433
19 R A -2.1370
20 L A 0.0000
21 S A -0.4979
22 C A 0.0000
23 A A -0.3616
24 A A 0.0000
25 S A -0.5872
26 G A -0.5951
27 F A 0.3109
28 P A 0.3905
29 V A 0.6590
30 N A -0.8813
31 F A 0.0000
32 Q A -0.9306
33 E A -1.1186
34 M A 0.0000
35 H A 0.0000
36 W A 0.0000
37 Y A -0.2102
38 R A 0.0000
39 Q A -1.9681
40 A A -1.8807
41 P A -1.3210
42 G A -1.8214
43 K A -2.9980
44 E A -3.4307
45 R A -2.7568
46 E A -1.5560
47 W A -0.4401
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 Y A -1.3985
53 S A -1.6833
54 N A -2.3997
55 G A -2.0293
56 Q A -2.2158
57 H A -2.2150
58 T A -1.5689
59 K A -2.0520
60 Y A -1.5941
61 A A -1.6281
62 D A -2.6238
63 S A -1.8012
64 V A 0.0000
65 K A -2.8538
66 G A -1.7914
67 R A -1.4864
68 F A 0.0000
69 T A -1.0507
70 I A 0.0000
71 S A -0.6533
72 R A -1.3233
73 D A -1.6677
74 N A -1.7140
75 A A -1.1003
76 K A -1.9937
77 N A -1.1905
78 T A 0.0000
79 V A 0.0000
80 Y A -0.6596
81 L A 0.0000
82 Q A -1.2587
83 M A 0.0000
84 N A -1.3549
85 S A -1.1480
86 L A 0.0000
87 K A -2.1997
88 P A -1.8772
89 E A -2.3102
90 D A 0.0000
91 T A -0.9108
92 A A 0.0000
93 V A -0.4068
94 Y A 0.0000
95 Y A -0.1468
96 C A 0.0000
97 N A 0.0000
98 V A 0.0000
99 K A -0.8940
100 D A 0.0000
101 Y A -0.0283
102 G A -0.1732
103 D A -0.8883
104 W A 0.8090
105 F A 1.3823
106 E A -0.5803
107 W A -0.0932
108 Y A -0.1755
109 D A -0.8986
110 Y A -0.2565
111 W A -0.0256
112 G A -0.2639
113 Q A -1.0640
114 G A 0.0000
115 T A -0.7055
116 Q A -1.0729
117 V A 0.0000
118 T A -0.2940
119 V A 0.0000
120 S A -0.7721
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018