Project name: 9b1ce0e396b5522

Chain sequence(s)	A: EVQLVESGGGLVQPGGSLRLSCAASGFTISNYGMSWVRQAPGKGLEWVSAITVSGGRAYYADSVKGRFTISRDNAKNTVYLQMNSLRAEDTAVYYCARDRVVVAGIAFDYWGQGTLVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	No
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       runJob:   FoldX not utilized. Treating input pdb file as it was already optimized.    (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:01)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:02)

• Minimal score value: -2.5112
• Maximal score value: 2.4143
• Average score: -0.3781
• Total score value: -45.7472

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
2	E	A	-2.0091
3	V	A	-0.9049
4	Q	A	-0.8203
5	L	A	0.0000
6	V	A	1.2148
7	E	A	0.5059
8	S	A	-0.1298
9	G	A	-0.6620
10	G	A	0.0885
11	G	A	0.6893
12	L	A	1.4013
13	V	A	-0.0675
14	Q	A	-1.4204
15	P	A	-1.9326
16	G	A	-1.5077
17	G	A	-1.0682
18	S	A	-1.2800
19	L	A	-0.9607
20	R	A	-2.0170
21	L	A	0.0000
22	S	A	-0.4031
23	C	A	0.0000
24	A	A	-0.0133
25	A	A	0.0000
26	S	A	-0.6810
27	G	A	-1.0979
28	F	A	-0.5973
29	T	A	-0.4980
30	I	A	0.0000
31	S	A	-0.8323
32	N	A	-0.5075
33	Y	A	0.3680
34	G	A	0.0000
35	M	A	0.0000
36	S	A	0.0000
37	W	A	0.0000
38	V	A	0.0000
39	R	A	0.0000
40	Q	A	-0.3652
41	A	A	-0.9749
42	P	A	-0.9429
43	G	A	-1.4109
44	K	A	-2.1067
45	G	A	-0.9589
46	L	A	0.4780
47	E	A	-0.4045
48	W	A	0.2954
49	V	A	0.0000
50	S	A	0.0000
51	A	A	0.0000
52	I	A	0.0000
53	T	A	0.0000
54	V	A	0.1689
55	S	A	-0.7302
56	G	A	-1.1846
57	G	A	-1.2924
58	R	A	-1.7646
59	A	A	-0.6976
60	Y	A	-0.1892
61	Y	A	-0.4682
62	A	A	-1.1317
63	D	A	-2.3920
64	S	A	-1.5687
65	V	A	0.0000
66	K	A	-2.5112
67	G	A	-1.7089
68	R	A	-1.2636
69	F	A	0.0000
70	T	A	-0.7455
71	I	A	0.0000
72	S	A	-0.6513
73	R	A	-0.9228
74	D	A	-1.4969
75	N	A	-1.5995
76	A	A	-1.3079
77	K	A	-2.2464
78	N	A	-1.6815
79	T	A	-0.9410
80	V	A	0.0000
81	Y	A	-0.5655
82	L	A	0.0000
83	Q	A	-1.2008
84	M	A	0.0000
85	N	A	-1.4502
86	S	A	-1.3003
87	L	A	0.0000
88	R	A	-2.5002
89	A	A	-1.8392
90	E	A	-2.2721
91	D	A	0.0000
92	T	A	-0.4606
93	A	A	0.0000
94	V	A	0.9475
95	Y	A	0.0000
96	Y	A	0.6448
97	C	A	0.0000
98	A	A	0.0000
99	R	A	0.0000
100	D	A	0.0000
101	R	A	0.3055
102	V	A	1.9512
103	V	A	2.3334
104	V	A	2.2777
105	A	A	1.6515
106	G	A	0.0000
107	I	A	2.4143
108	A	A	0.9105
109	F	A	0.7725
110	D	A	-0.3990
111	Y	A	0.4755
112	W	A	0.6836
113	G	A	0.0000
114	Q	A	-0.6111
115	G	A	0.1563
116	T	A	0.6095
117	L	A	1.5594
118	V	A	0.0000
119	T	A	0.3356
120	V	A	0.0000
121	S	A	-0.8116
122	S	A	-0.5052