Project name: obj1 [mutate: VL5C, EW6C, GS9C, TH58C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	GS9C,EW6C,VL5C,TH58C
Energy difference between WT (input) and mutated protein (by FoldX)	40.4591 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:37)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:00)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:01)

• Minimal score value: -3.3333
• Maximal score value: 1.8934
• Average score: -0.6775
• Total score value: -81.2961

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0063
2	V	C	-0.9167
3	Q	C	-1.3734
4	L	C	0.0000
5	L	C	0.3031	mutated: VL5C
6	W	C	0.5679	mutated: EW6C
7	S	C	-0.2126
8	G	C	-0.6108
9	S	C	0.2613	mutated: GS9C
10	G	C	0.9650
11	L	C	1.4486
12	V	C	-0.0378
13	Q	C	-1.3427
14	P	C	-1.4908
15	G	C	-1.4157
16	G	C	-0.9808
17	S	C	-1.2291
18	L	C	-0.9211
19	R	C	-2.1049
20	L	C	0.0000
21	S	C	-0.4318
22	C	C	0.0000
23	A	C	-0.2661
24	A	C	0.0000
25	S	C	-0.2782
26	D	C	0.0000
27	F	C	1.5458
28	T	C	0.2525
29	F	C	0.0000
30	R	C	-2.0296
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.2402
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2855
40	A	C	-0.9852
41	P	C	-1.2937
42	G	C	-1.4348
43	K	C	-2.1350
44	G	C	-1.0592
45	L	C	0.3948
46	E	C	-0.3909
47	W	C	0.3359
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.8035
53	G	C	-1.2375
54	S	C	-1.2168
55	G	C	-1.2738
56	G	C	-0.9377
57	S	C	-0.7539
58	H	C	-0.7598	mutated: TH58C
59	Y	C	0.1305
60	Y	C	-0.5973
61	A	C	-1.1533
62	D	C	-2.3518
63	S	C	-1.7197
64	V	C	0.0000
65	K	C	-2.3939
66	G	C	-1.6216
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.8109
70	I	C	0.0000
71	S	C	-0.7075
72	R	C	-1.3573
73	D	C	-1.9777
74	N	C	-2.1871
75	S	C	-1.7905
76	K	C	-2.3179
77	N	C	-1.6518
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6072
81	L	C	0.0000
82	Q	C	-1.2317
83	M	C	0.0000
84	N	C	-1.3302
85	S	C	-1.2310
86	L	C	0.0000
87	R	C	-2.4732
88	A	C	-1.8897
89	E	C	-2.3442
90	D	C	0.0000
91	T	C	-0.4300
92	A	C	0.0000
93	I	C	1.1242
94	Y	C	0.0000
95	Y	C	0.7324
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1907
101	D	C	-3.3333
102	G	C	-2.0866
103	F	C	-1.2310
104	N	C	-2.4286
105	K	C	-3.1848
106	G	C	-1.9076
107	F	C	-0.9866
108	D	C	-1.1003
109	Y	C	-0.2116
110	W	C	0.5526
111	G	C	-0.0767
112	Q	C	-0.8505
113	G	C	0.0000
114	T	C	0.0000
115	L	C	1.8934
116	V	C	0.0000
117	T	C	0.3449
118	V	C	0.0000
119	S	C	-0.7695
120	S	C	-1.0575