Project name: envmab

Status: done

Started: 2026-03-19 11:48:50
Settings
Chain sequence(s) A: QVQLVESGGGLVQPGGSLRLSCAASGKMSSRRCMAWFRQAPGKERERVAKLLTTSGSTYLADSVKGRFTISRDNSKNTVYLQMNSLRAEDTAVYYCAADSFEDPTCTLVTSSGAFQYWGQGTLVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:35)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:36)
Show buried residues

Minimal score value
-3.4821
Maximal score value
1.7426
Average score
-0.7769
Total score value
-99.4494

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -2.0085
2 V A 0.0000
3 Q A -1.4907
4 L A 0.0000
5 V A 1.0696
6 E A 0.4127
7 S A -0.2744
8 G A -0.7990
9 G A 0.0886
10 G A 0.6312
11 L A 1.3285
12 V A 0.0000
13 Q A -1.4993
14 P A -1.8891
15 G A -1.6673
16 G A -1.1977
17 S A -1.6196
18 L A -1.2461
19 R A -2.3456
20 L A 0.0000
21 S A -0.6135
22 C A 0.0000
23 A A -0.2011
24 A A 0.0000
25 S A -1.3678
26 G A -2.0294
27 K A -2.3628
28 M A -1.4840
29 S A -1.1849
30 S A -1.2259
31 R A -1.8846
32 R A -1.1309
33 C A 0.0000
34 M A 0.0000
35 A A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A 0.0000
39 Q A -1.7314
40 A A -1.6435
41 P A -1.5371
42 G A -1.9165
43 K A -3.3070
44 E A -3.4821
45 R A -2.7612
46 E A -2.6007
47 R A -1.2220
48 V A 0.0000
49 A A 0.0000
50 K A 0.0000
51 L A 0.0000
52 L A 0.0000
53 T A -1.1345
54 T A -0.6976
55 S A -0.5019
56 G A -0.5027
57 S A 0.0106
58 T A 0.5054
59 Y A 0.8460
60 L A -0.2177
61 A A -1.1902
62 D A -2.2857
63 S A -1.5494
64 V A 0.0000
65 K A -2.4348
66 G A -1.8497
67 R A -1.6436
68 F A 0.0000
69 T A -0.8899
70 I A 0.0000
71 S A -1.1279
72 R A -2.3686
73 D A -2.5210
74 N A -2.7102
75 S A -2.1155
76 K A -2.7991
77 N A -2.2188
78 T A 0.0000
79 V A 0.0000
80 Y A -1.0675
81 L A 0.0000
82 Q A -1.7519
83 M A 0.0000
84 N A -2.1505
85 S A -1.6399
86 L A 0.0000
87 R A -2.9029
88 A A -1.9972
89 E A -2.4283
90 D A 0.0000
91 T A -0.4932
92 A A 0.0000
93 V A 0.7787
94 Y A 0.0000
95 Y A 0.0399
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 D A 0.0000
100 S A -0.8897
101 F A -0.9424
102 E A -2.1847
103 D A -1.2459
104 P A -1.1487
105 T A -0.3802
106 C A 0.0000
107 T A 0.2706
108 L A 0.8799
109 V A 0.0000
110 T A -0.0565
111 S A -0.6429
112 S A -1.1377
113 G A -0.7686
114 A A -0.4088
115 F A 0.0000
116 Q A -1.1069
117 Y A -0.5706
118 W A -0.1096
119 G A -0.1718
120 Q A -0.9126
121 G A 0.0688
122 T A 0.6003
123 L A 1.7426
124 V A 0.0000
125 T A 0.2689
126 V A 0.0000
127 S A -0.8709
128 S A -0.5293
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018