Project name: obj1 [mutate: GA10C, VQ12C, CL22C, SN120C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	CL22C,VQ12C,SN120C,GA10C
Energy difference between WT (input) and mutated protein (by FoldX)	14.7255 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:28)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:38)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:03)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:04)

• Minimal score value: -3.3333
• Maximal score value: 1.8657
• Average score: -0.6648
• Total score value: -79.7733

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0219
2	V	C	-0.9489
3	Q	C	-1.1259
4	L	C	0.0000
5	V	C	1.1275
6	E	C	0.5070
7	S	C	-0.2257
8	G	C	-0.6974
9	G	C	0.1795
10	A	C	1.1173	mutated: GA10C
11	L	C	1.3597
12	Q	C	-0.5172	mutated: VQ12C
13	Q	C	-1.7547
14	P	C	-1.8244
15	G	C	-1.4308
16	G	C	-1.0029
17	S	C	-1.2219
18	L	C	-0.9205
19	R	C	-2.1005
20	L	C	0.0000
21	S	C	-0.4364
22	L	C	0.0000	mutated: CL22C
23	A	C	0.0007
24	A	C	0.0000
25	S	C	-0.1178
26	D	C	0.0000
27	F	C	1.5451
28	T	C	0.2509
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1454
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2969
40	A	C	-0.9843
41	P	C	-1.2937
42	G	C	-1.4348
43	K	C	-2.1350
44	G	C	-1.0592
45	L	C	0.3948
46	E	C	-0.3909
47	W	C	0.3405
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5831
53	G	C	-1.2447
54	S	C	-1.2286
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3025
58	T	C	0.1989
59	Y	C	0.6077
60	Y	C	-0.3557
61	A	C	-1.1382
62	D	C	-2.3439
63	S	C	-1.7141
64	V	C	0.0000
65	K	C	-2.3844
66	G	C	-1.6176
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6719
70	I	C	0.0000
71	S	C	-0.5621
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6453
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6685
81	L	C	0.0000
82	Q	C	-1.2160
83	M	C	0.0000
84	N	C	-1.2871
85	S	C	-1.1913
86	L	C	0.0000
87	R	C	-2.7161
88	A	C	-2.3194
89	E	C	-2.4980
90	D	C	0.0000
91	T	C	-0.5639
92	A	C	0.0000
93	I	C	1.1155
94	Y	C	0.0000
95	Y	C	0.7183
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1907
101	D	C	-3.3333
102	G	C	-2.0866
103	F	C	-1.2310
104	N	C	-2.4286
105	K	C	-3.1848
106	G	C	-1.9076
107	F	C	-0.9859
108	D	C	-1.1040
109	Y	C	-0.2190
110	W	C	0.6259
111	G	C	0.1075
112	Q	C	-0.7347
113	G	C	0.2210
114	T	C	0.7286
115	L	C	1.8657
116	V	C	0.0000
117	T	C	0.1755
118	V	C	0.0000
119	S	C	-1.4339
120	N	C	-2.1903	mutated: SN120C