Project name: query_structure

Status: done

Started: 2026-03-17 00:06:19
Settings
Chain sequence(s) A: MAVSDVPRKLEVVAATPTSLLISWDYQYYYYAYYRITYGETGGNSPVQEFTVPYGSYTATISGLKPGVDYTITVYAVTYWSTSFSISINYRT
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:10)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:11)
Show buried residues

Minimal score value
-3.0242
Maximal score value
2.4357
Average score
-0.2804
Total score value
-25.7966

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 1.3035
2 A A 0.8901
3 V A 0.9516
4 S A 0.1869
5 D A -0.1354
6 V A -0.4106
7 P A 0.0000
8 R A -2.7293
9 K A -3.0242
10 L A 0.0000
11 E A -1.9957
12 V A 0.0943
13 V A 1.5427
14 A A 0.9082
15 A A 0.3395
16 T A -0.3316
17 P A -1.1131
18 T A -0.9931
19 S A -0.5161
20 L A 0.0000
21 L A 0.7751
22 I A 0.0000
23 S A -0.6632
24 W A 0.0000
25 D A -2.6418
26 Y A 0.0000
27 Q A -1.1255
28 Y A 0.5979
29 Y A 1.7509
30 Y A 2.1651
31 Y A 2.4357
32 A A 0.0000
33 Y A 1.3302
34 Y A 0.0000
35 R A -0.4814
36 I A 0.0000
37 T A 0.0000
38 Y A -0.5445
39 G A -0.9189
40 E A -1.7774
41 T A -1.3550
42 G A -1.2754
43 G A -1.5022
44 N A -1.6172
45 S A -1.0133
46 P A -0.5751
47 V A -0.0679
48 Q A -1.3818
49 E A -1.9213
50 F A -0.7846
51 T A -0.1641
52 V A 0.0000
53 P A 0.4180
54 Y A 1.3511
55 G A 0.4229
56 S A 0.0818
57 Y A 0.0529
58 T A 0.0530
59 A A 0.0000
60 T A 0.2466
61 I A 0.0000
62 S A -0.6586
63 G A -1.0282
64 L A 0.0000
65 K A -2.3832
66 P A -1.6562
67 G A -1.4493
68 V A -1.4555
69 D A -2.1270
70 Y A 0.0000
71 T A -0.8587
72 I A 0.0000
73 T A -0.3584
74 V A 0.0000
75 Y A 0.3642
76 A A 0.0000
77 V A 1.1608
78 T A 0.0000
79 Y A 2.3070
80 W A 1.7517
81 S A 0.8555
82 T A 0.6120
83 S A 0.3969
84 F A 0.4521
85 S A 0.1704
86 I A -0.0692
87 S A -0.6471
88 I A -0.7280
89 N A -1.7487
90 Y A -1.4946
91 R A -2.5404
92 T A -1.5024
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018