Project name: 9d4ff2651e83157

Chain sequence(s)	A: MATLCLGHHSGVESPEFIENGWEGMVDGWYGFRHQNSEGRGQAAIKTEPTVENLNKLFEKTKKQLRENAEDMGNGCFKIYHKCDNACFQEILEKVKA
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:27)

• Minimal score value: -4.0618
• Maximal score value: 0.6019
• Average score: -1.4348
• Total score value: -139.1736

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.4090
2	A	A	0.0000
3	T	A	-0.4524
4	L	A	0.0000
5	C	A	-0.5322
6	L	A	0.0000
7	G	A	0.0000
8	H	A	0.0000
9	H	A	-1.0881
10	S	A	-1.5862
11	G	A	-1.1113
12	V	A	-0.8684
13	E	A	-2.2462
14	S	A	-2.0011
15	P	A	0.0000
16	E	A	-2.5443
17	F	A	-1.5284
18	I	A	0.0000
19	E	A	-3.0160
20	N	A	-2.9207
21	G	A	-1.9565
22	W	A	-1.2228
23	E	A	-2.0936
24	G	A	-1.1080
25	M	A	0.0000
26	V	A	0.6019
27	D	A	-1.2316
28	G	A	-0.9660
29	W	A	-0.5174
30	Y	A	0.0000
31	G	A	0.0000
32	F	A	0.0000
33	R	A	-1.5856
34	H	A	0.0000
35	Q	A	-2.2056
36	N	A	0.0000
37	S	A	-1.7784
38	E	A	-2.7646
39	G	A	-2.3928
40	R	A	-3.0964
41	G	A	-2.1947
42	Q	A	-1.7343
43	A	A	-1.0555
44	A	A	-0.8813
45	I	A	0.0000
46	K	A	-2.5067
47	T	A	-1.8357
48	E	A	-2.3011
49	P	A	-1.5959
50	T	A	-1.4897
51	V	A	-1.5399
52	E	A	-2.5807
53	N	A	-2.0861
54	L	A	0.0000
55	N	A	-2.1661
56	K	A	-2.9887
57	L	A	-2.2177
58	F	A	0.0000
59	E	A	-3.1413
60	K	A	-3.1647
61	T	A	0.0000
62	K	A	-3.7844
63	K	A	-3.7530
64	Q	A	-2.9593
65	L	A	0.0000
66	R	A	-4.0618
67	E	A	-3.4571
68	N	A	-2.3257
69	A	A	-2.1086
70	E	A	-2.1886
71	D	A	-1.8900
72	M	A	-0.6760
73	G	A	-0.8910
74	N	A	-1.6845
75	G	A	0.0000
76	C	A	-0.7175
77	F	A	0.0000
78	K	A	-0.7639
79	I	A	0.0000
80	Y	A	-0.1195
81	H	A	-1.2609
82	K	A	-1.7938
83	C	A	0.0000
84	D	A	-1.8498
85	N	A	-1.9508
86	A	A	-1.0844
87	C	A	-1.3059
88	F	A	0.0000
89	Q	A	-2.7862
90	E	A	-3.2913
91	I	A	-2.4509
92	L	A	0.0000
93	E	A	-4.0515
94	K	A	-3.7563
95	V	A	0.0000
96	K	A	-3.0608
97	A	A	-1.8663