Project name: DHC-WR

Status: done

Started: 2026-01-16 02:15:22
Settings
Chain sequence(s) A: QVQLVQSGAEVKKPGSSVKVSCKASGGSFSRLAFSWVRQAPGQGLEWMGGIIPIIGTADYAQKFQGRVTITADESTNTAYMELSSLRSEDTAVYYCARDLSSGYSDALDIWGQGSVITVSSASTKGPEVQLVESGGGVVQPGRSLRLSCTASGFAFGDYAMSWVRQAPGKGLEWVGFIRSKTYGATTEYAASVKGRFAISRDDSKGIAYLQMNSLRAEDTAVYYCARGITGYAGYDYWGQGTLVTVSS
B: SYELTQPLSVSVSPGQTSTITCSGEALGDRYASWYQQRPGQSPILVIYQDTKRPSGIPERFSGSSSRGTATLTISGTQATDEADYYCQTWDRSTGVFGTGTKVTVLRTVAAPSVFIFPPDIQMTQSPSTLSASVGDRVTITCRASYSVSPWLAWYQQKPGKAPKLLIYAASSLQRGVPSRFSGSGSGTEFTLTISSLQAEDVAVYYCQQSYSAPLTFGGGTKVEIK
input PDB
Selected Chain(s) A,B
Distance of aggregation 5 Å
FoldX usage Yes
Dynamic mode No
Automated mutations Yes
Downloads Download all the data
Simulation log 
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:07:12)
[INFO]       Auto_mut: Residue number 116 from chain B and a score of 2.702 (isoleucine) selected  
                       for automated muatation                                                     (00:07:18)
[INFO]       Auto_mut: Residue number 115 from chain B and a score of 2.656 (phenylalanine)        
                       selected for automated muatation                                            (00:07:18)
[INFO]       Auto_mut: Residue number 117 from chain B and a score of 2.267 (phenylalanine)        
                       selected for automated muatation                                            (00:07:18)
[INFO]       Auto_mut: Residue number 55 from chain A and a score of 2.112 (isoleucine) selected   
                       for automated muatation                                                     (00:07:18)
[INFO]       Auto_mut: Residue number 114 from chain B and a score of 2.105 (valine) selected for  
                       automated muatation                                                         (00:07:18)
[INFO]       Auto_mut: Residue number 109 from chain B and a score of 1.765 (valine) selected for  
                       automated muatation                                                         (00:07:18)
[INFO]       Auto_mut: Mutating residue number 116 from chain B (isoleucine) into glutamic acid    (00:07:18)
[INFO]       Auto_mut: Mutating residue number 116 from chain B (isoleucine) into aspartic acid    (00:07:18)
[INFO]       Auto_mut: Mutating residue number 115 from chain B (phenylalanine) into glutamic acid 
                       Mutating residue number 115 from chain B (phenylalanine) into glutamic acid (00:07:18)
[INFO]       Auto_mut: Mutating residue number 116 from chain B (isoleucine) into lysine           (00:10:45)
[INFO]       Auto_mut: Mutating residue number 116 from chain B (isoleucine) into arginine         (00:10:48)
[INFO]       Auto_mut: Mutating residue number 115 from chain B (phenylalanine) into lysine        (00:10:55)
[INFO]       Auto_mut: Mutating residue number 115 from chain B (phenylalanine) into aspartic acid 
                       Mutating residue number 115 from chain B (phenylalanine) into aspartic acid (00:14:28)
[INFO]       Auto_mut: Mutating residue number 117 from chain B (phenylalanine) into glutamic acid 
                       Mutating residue number 117 from chain B (phenylalanine) into glutamic acid (00:14:29)
[INFO]       Auto_mut: Mutating residue number 117 from chain B (phenylalanine) into aspartic acid 
                       Mutating residue number 117 from chain B (phenylalanine) into aspartic acid (00:14:33)
[INFO]       Auto_mut: Mutating residue number 115 from chain B (phenylalanine) into arginine      (00:17:42)
[INFO]       Auto_mut: Mutating residue number 117 from chain B (phenylalanine) into arginine      (00:17:55)
[INFO]       Auto_mut: Mutating residue number 117 from chain B (phenylalanine) into lysine        (00:18:09)
[INFO]       Auto_mut: Mutating residue number 55 from chain A (isoleucine) into glutamic acid     (00:21:16)
[INFO]       Auto_mut: Mutating residue number 55 from chain A (isoleucine) into aspartic acid     (00:21:39)
[INFO]       Auto_mut: Mutating residue number 114 from chain B (valine) into glutamic acid        (00:22:23)
[INFO]       Auto_mut: Mutating residue number 55 from chain A (isoleucine) into lysine            (00:24:42)
[INFO]       Auto_mut: Mutating residue number 55 from chain A (isoleucine) into arginine          (00:24:49)
[INFO]       Auto_mut: Mutating residue number 114 from chain B (valine) into lysine               (00:25:49)
[INFO]       Auto_mut: Mutating residue number 114 from chain B (valine) into aspartic acid        (00:28:21)
[INFO]       Auto_mut: Mutating residue number 109 from chain B (valine) into glutamic acid        (00:28:28)
[INFO]       Auto_mut: Mutating residue number 109 from chain B (valine) into aspartic acid        (00:29:15)
[INFO]       Auto_mut: Mutating residue number 114 from chain B (valine) into arginine             (00:31:45)
[INFO]       Auto_mut: Mutating residue number 109 from chain B (valine) into lysine               (00:31:50)
[INFO]       Auto_mut: Mutating residue number 109 from chain B (valine) into arginine             (00:32:36)
[INFO]       Auto_mut: Effect of mutation residue number 116 from chain B (isoleucine) into        
                       glutamic acid: Energy difference: -0.5794 kcal/mol, Difference in average   
                       score from the base case: -0.0054                                           (00:36:48)
[INFO]       Auto_mut: Effect of mutation residue number 116 from chain B (isoleucine) into        
                       lysine: Energy difference: -0.4453 kcal/mol, Difference in average score    
                       from the base case: -0.0054                                                 (00:36:48)
[INFO]       Auto_mut: Effect of mutation residue number 116 from chain B (isoleucine) into        
                       aspartic acid: Energy difference: -0.0358 kcal/mol, Difference in average   
                       score from the base case: -0.0057                                           (00:36:48)
[INFO]       Auto_mut: Effect of mutation residue number 116 from chain B (isoleucine) into        
                       arginine: Energy difference: -0.8255 kcal/mol, Difference in average score  
                       from the base case: -0.0065                                                 (00:36:48)
[INFO]       Auto_mut: Effect of mutation residue number 115 from chain B (phenylalanine) into     
                       glutamic acid: Energy difference: 0.3248 kcal/mol, Difference in average    
                       score from the base case: -0.0054                                           (00:36:48)
[INFO]       Auto_mut: Effect of mutation residue number 115 from chain B (phenylalanine) into     
                       lysine: Energy difference: 0.3370 kcal/mol, Difference in average score     
                       from the base case: -0.0052                                                 (00:36:48)
[INFO]       Auto_mut: Effect of mutation residue number 115 from chain B (phenylalanine) into     
                       aspartic acid: Energy difference: 0.2208 kcal/mol, Difference in average    
                       score from the base case: -0.0058                                           (00:36:48)
[INFO]       Auto_mut: Effect of mutation residue number 115 from chain B (phenylalanine) into     
                       arginine: Energy difference: 0.4399 kcal/mol, Difference in average score   
                       from the base case: -0.0059                                                 (00:36:48)
[INFO]       Auto_mut: Effect of mutation residue number 117 from chain B (phenylalanine) into     
                       glutamic acid: Energy difference: 0.3210 kcal/mol, Difference in average    
                       score from the base case: -0.0069                                           (00:36:48)
[INFO]       Auto_mut: Effect of mutation residue number 117 from chain B (phenylalanine) into     
                       lysine: Energy difference: 0.3827 kcal/mol, Difference in average score     
                       from the base case: -0.0061                                                 (00:36:48)
[INFO]       Auto_mut: Effect of mutation residue number 117 from chain B (phenylalanine) into     
                       aspartic acid: Energy difference: 1.2836 kcal/mol, Difference in average    
                       score from the base case: -0.0067                                           (00:36:48)
[INFO]       Auto_mut: Effect of mutation residue number 117 from chain B (phenylalanine) into     
                       arginine: Energy difference: -0.2998 kcal/mol, Difference in average score  
                       from the base case: -0.0060                                                 (00:36:48)
[INFO]       Auto_mut: Effect of mutation residue number 55 from chain A (isoleucine) into         
                       glutamic acid: Energy difference: 0.0524 kcal/mol, Difference in average    
                       score from the base case: -0.0076                                           (00:36:48)
[INFO]       Auto_mut: Effect of mutation residue number 55 from chain A (isoleucine) into lysine: 
                       Energy difference: -0.0542 kcal/mol, Difference in average score from the   
                       base case: -0.0058                                                          (00:36:48)
[INFO]       Auto_mut: Effect of mutation residue number 55 from chain A (isoleucine) into         
                       aspartic acid: Energy difference: 0.6989 kcal/mol, Difference in average    
                       score from the base case: -0.0073                                           (00:36:49)
[INFO]       Auto_mut: Effect of mutation residue number 55 from chain A (isoleucine) into         
                       arginine: Energy difference: 0.1886 kcal/mol, Difference in average score   
                       from the base case: -0.0065                                                 (00:36:49)
[INFO]       Auto_mut: Effect of mutation residue number 114 from chain B (valine) into glutamic   
                       acid: Energy difference: -0.5575 kcal/mol, Difference in average score from 
                       the base case: -0.0053                                                      (00:36:49)
[INFO]       Auto_mut: Effect of mutation residue number 114 from chain B (valine) into lysine:    
                       Energy difference: -0.1578 kcal/mol, Difference in average score from the   
                       base case: -0.0048                                                          (00:36:49)
[INFO]       Auto_mut: Effect of mutation residue number 114 from chain B (valine) into aspartic   
                       acid: Energy difference: -0.1057 kcal/mol, Difference in average score from 
                       the base case: -0.0051                                                      (00:36:49)
[INFO]       Auto_mut: Effect of mutation residue number 114 from chain B (valine) into arginine:  
                       Energy difference: -0.2478 kcal/mol, Difference in average score from the   
                       base case: -0.0053                                                          (00:36:49)
[INFO]       Auto_mut: Effect of mutation residue number 109 from chain B (valine) into glutamic   
                       acid: Energy difference: -0.6068 kcal/mol, Difference in average score from 
                       the base case: -0.0055                                                      (00:36:49)
[INFO]       Auto_mut: Effect of mutation residue number 109 from chain B (valine) into lysine:    
                       Energy difference: -0.8677 kcal/mol, Difference in average score from the   
                       base case: -0.0035                                                          (00:36:49)
[INFO]       Auto_mut: Effect of mutation residue number 109 from chain B (valine) into aspartic   
                       acid: Energy difference: 0.0302 kcal/mol, Difference in average score from  
                       the base case: -0.0053                                                      (00:36:49)
[INFO]       Auto_mut: Effect of mutation residue number 109 from chain B (valine) into arginine:  
                       Energy difference: -0.2754 kcal/mol, Difference in average score from the   
                       base case: -0.0026                                                          (00:36:49)
[INFO]       Main:     Simulation completed successfully.                                          (00:37:02)
Show buried residues
Minimal score value
-2.0156
Maximal score value
2.7017
Average score
-0.2059
Total score value
-97.5792
Download the table (csv)

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 Q A -1.1983
2 V A 0.0000
3 Q A -1.1983
4 L A 0.0000
5 V A 1.4696
6 Q A 0.0000
7 S A -0.1482
8 G A -0.4671
9 A A -0.1161
10 E A -1.1297
11 V A 0.5909
12 K A -0.6694
13 K A -1.8125
14 P A -0.4830
15 G A -0.5170
16 S A -0.1470
17 S A -0.0884
18 V A 0.0000
19 K A -1.8102
20 V A 0.0000
21 S A -0.0189
22 C A 0.0000
23 K A -1.0974
24 A A 0.0000
25 S A -0.1687
26 G A -0.5253
27 G A -0.3690
28 S A -0.2592
29 F A 0.0000
30 S A -0.2675
31 R A -1.8152
32 L A -0.1573
33 A A 0.0000
34 F A 0.0000
35 S A 0.0000
36 W A 0.0000
37 V A 0.0000
38 R A -0.2457
39 Q A -0.1756
40 A A -0.0617
41 P A -0.3399
42 G A -0.7324
43 Q A -1.3073
44 G A -0.3514
45 L A 0.0000
46 E A -0.3261
47 W A 0.0000
48 M A 0.0000
49 G A 0.0000
50 G A 0.0000
51 I A 0.0000
52 I A 0.2198
53 P A 0.0000
54 I A 1.3800
55 I A 2.1121
56 G A -0.1147
57 T A -0.1511
58 A A -0.0821
59 D A -0.3793
60 Y A 0.1887
61 A A 0.0000
62 Q A -1.5189
63 K A -1.9260
64 F A 0.0000
65 Q A -1.2822
66 G A -0.7695
67 R A -0.5441
68 V A 0.0000
69 T A -0.0519
70 I A 0.0000
71 T A -0.0311
72 A A -0.1329
73 D A -0.9931
74 E A -1.6600
75 S A -0.4919
76 T A -0.1763
77 N A -0.6023
78 T A 0.0000
79 A A 0.0000
80 Y A 0.2172
81 M A 0.0000
82 E A -0.9975
83 L A 0.0000
84 S A -0.1214
85 S A -0.2739
86 L A 0.0000
87 R A -1.8844
88 S A -0.8905
89 E A -1.8583
90 D A 0.0000
91 T A -0.0141
92 A A 0.0000
93 V A 0.5267
94 Y A 0.0000
95 Y A 0.0000
96 C A 0.0000
97 A A 0.0000
98 R A -0.2520
99 D A 0.0000
100 L A 0.6260
101 S A -0.0117
102 S A -0.2580
103 G A -0.1630
104 Y A 0.1902
105 S A -0.0367
106 D A 0.0000
107 A A 0.0000
108 L A 0.0000
109 D A -0.3079
110 I A 0.1815
111 W A 0.1576
112 G A 0.0000
113 Q A -1.2086
114 G A -0.2785
115 S A 0.0000
116 V A 1.1915
117 I A 0.0000
118 T A 0.0975
119 V A 0.0000
120 S A -0.0922
121 S A -0.2118
122 A A -0.0178
123 S A -0.2142
124 T A -0.4074
125 K A -1.7628
126 G A -0.6304
127 P A -0.6144
128 E A -1.5579
129 V A -0.2670
130 Q A -1.0613
131 L A 0.0000
132 V A 0.9891
133 E A 0.0000
134 S A -0.2245
135 G A -0.3881
136 G A -0.3186
137 G A 0.0843
138 V A 1.7299
139 V A 0.0000
140 Q A -1.1819
141 P A -0.4116
142 G A -0.8478
143 R A -1.9687
144 S A -0.5905
145 L A -0.1162
146 R A -1.8393
147 L A 0.0000
148 S A -0.0185
149 C A 0.0000
150 T A -0.0064
151 A A 0.0000
152 S A -0.2126
153 G A -0.2081
154 F A 0.2717
155 A A 0.1133
156 F A 0.0000
157 G A -0.4145
158 D A -1.7629
159 Y A -0.1035
160 A A -0.0033
161 M A 0.0000
162 S A 0.0000
163 W A 0.0000
164 V A 0.0000
165 R A 0.0000
166 Q A -0.1478
167 A A -0.0640
168 P A -0.3408
169 G A -0.8245
170 K A -1.8128
171 G A -0.4624
172 L A 0.0000
173 E A -0.7428
174 W A 0.0000
175 V A 0.0000
176 G A 0.0000
177 F A 0.2441
178 I A 0.0000
179 R A -0.3782
180 S A 0.0000
181 K A -1.7117
182 T A -0.2885
183 Y A 0.4670
184 G A -0.3640
185 A A -0.3022
186 T A -0.0384
187 T A -0.1883
188 E A -0.8219
189 Y A 0.0166
190 A A 0.0000
191 A A 0.0205
192 S A -0.1944
193 V A 0.0000
194 K A -1.7848
195 G A -0.8344
196 R A -0.4023
197 F A 0.0000
198 A A -0.0054
199 I A 0.0000
200 S A -0.1855
201 R A -0.3291
202 D A -0.5074
203 D A -0.5491
204 S A -0.6043
205 K A -1.7389
206 G A 0.0000
207 I A 0.2430
208 A A 0.0000
209 Y A 0.2006
210 L A 0.0000
211 Q A -0.5708
212 M A 0.0000
213 N A -0.6146
214 S A -0.3470
215 L A 0.0000
216 R A -1.8235
217 A A -0.6130
218 E A -1.8094
219 D A 0.0000
220 T A -0.0153
221 A A 0.0000
222 V A 0.5403
223 Y A 0.0000
224 Y A 0.0000
225 C A 0.0000
226 A A 0.0000
227 R A 0.0000
228 G A -0.0020
229 I A 0.2479
230 T A -0.0364
231 G A -0.0171
232 Y A 0.6297
233 A A 0.0000
234 G A 0.0000
235 Y A 0.0000
236 D A -0.1689
237 Y A 0.2770
238 W A 0.1773
239 G A 0.0000
240 Q A -1.2108
241 G A -0.2917
242 T A 0.2530
243 L A 1.5004
244 V A 0.0000
245 T A 0.1870
246 V A 0.0000
247 S A -0.1417
248 S A -0.2314
1 S B 0.0166
2 Y B 0.9351
3 E B -1.5720
4 L B 0.0000
5 T B -0.0709
6 Q B 0.0000
7 P B 0.2038
8 L B 1.4999
9 S B 0.1287
10 V B 0.2268
11 S B -0.1608
12 V B 0.0000
13 S B 0.0136
14 P B -0.2219
15 G B -0.7165
16 Q B -1.1918
17 T B -0.2954
18 S B 0.0000
19 T B -0.0721
20 I B 0.0000
21 T B -0.0449
22 C B 0.0000
23 S B -0.0788
24 G B -0.4315
25 E B -1.8343
26 A B 0.0000
27 L B 0.0000
28 G B -0.8027
29 D B -1.9689
30 R B -0.6428
31 Y B 0.9204
32 A B 0.0000
33 S B 0.0000
34 W B 0.0000
35 Y B 0.0000
36 Q B 0.0000
37 Q B 0.0000
38 R B -0.9327
39 P B -0.5077
40 G B -0.7215
41 Q B -1.2292
42 S B -0.2452
43 P B 0.0000
44 I B 0.9069
45 L B 0.0000
46 V B 0.0000
47 I B 0.0000
48 Y B 0.1450
49 Q B -0.2008
50 D B -0.3581
51 T B -0.3422
52 K B -1.2897
53 R B -0.9047
54 P B -0.2079
55 S B -0.3040
56 G B -0.4475
57 I B 0.1894
58 P B -0.3517
59 E B -1.9024
60 R B -0.7277
61 F B 0.0000
62 S B -0.1011
63 G B 0.0000
64 S B -0.2334
65 S B -0.1810
66 S B -0.5301
67 R B -1.8910
68 G B -0.4938
69 T B -0.0423
70 A B 0.0000
71 T B -0.0189
72 L B 0.0000
73 T B -0.0247
74 I B 0.0000
75 S B -0.2134
76 G B -0.2333
77 T B 0.0000
78 Q B -0.9520
79 A B -0.1671
80 T B -0.0655
81 D B 0.0000
82 E B -0.3526
83 A B 0.0000
84 D B -0.6537
85 Y B 0.0000
86 Y B 0.0000
87 C B 0.0000
88 Q B 0.0000
89 T B 0.0000
90 W B 0.0000
91 D B -0.7074
92 R B -1.9157
93 S B -0.3530
94 T B -0.0274
95 G B -0.0083
96 V B 0.2233
97 F B 0.0000
98 G B 0.0000
99 T B -0.0801
100 G B -0.0634
101 T B 0.0000
102 K B -0.5266
103 V B 0.0000
104 T B -0.0381
105 V B 0.0000
106 L B 0.5218
107 R B -0.3436
108 T B 0.2391
109 V B 1.7649
110 A B 0.3649
111 A B 0.0275
112 P B -0.2249
113 S B 0.0613
114 V B 2.1052
115 F B 2.6565
116 I B 2.7017
117 F B 2.2674
118 P B 0.2659
119 P B -0.3618
120 D B -0.6493
121 I B 0.0000
122 Q B -1.1983
123 M B 0.0000
124 T B -0.0659
125 Q B 0.0000
126 S B -0.1700
127 P B -0.1759
128 S B -0.2435
129 T B -0.1743
130 L B 0.2769
131 S B -0.2781
132 A B 0.0000
133 S B 0.2255
134 V B 1.5229
135 G B -0.3093
136 D B -1.2948
137 R B -2.0156
138 V B 0.0000
139 T B -0.0699
140 I B 0.0000
141 T B -0.0204
142 C B 0.0000
143 R B -1.7649
144 A B 0.0000
145 S B -0.0057
146 Y B 0.8464
147 S B -0.0474
148 V B 0.0000
149 S B -0.1283
150 P B -0.1692
151 W B 0.0000
152 L B 0.0000
153 A B 0.0000
154 W B 0.0000
155 Y B 0.0000
156 Q B 0.0000
157 Q B 0.0000
158 K B -0.4390
159 P B -0.4145
160 G B -0.8267
161 K B -1.7840
162 A B -0.3040
163 P B 0.0000
164 K B -1.1805
165 L B 0.0000
166 L B 0.0000
167 I B 0.0000
168 Y B 0.3210
169 A B 0.0715
170 A B 0.0000
171 S B -0.2545
172 S B 0.0090
173 L B 0.5690
174 Q B -0.3820
175 R B -1.9551
176 G B -0.7578
177 V B 0.0935
178 P B -0.1156
179 S B -0.2907
180 R B -0.3412
181 F B 0.0000
182 S B -0.1853
183 G B -0.1568
184 S B -0.2895
185 G B -0.3148
186 S B -0.2454
187 G B -0.1624
188 T B -0.3628
189 E B -1.7678
190 F B 0.0000
191 T B -0.0217
192 L B 0.0000
193 T B -0.0240
194 I B 0.0000
195 S B -0.3090
196 S B -0.1507
197 L B 0.0000
198 Q B -0.3885
199 A B -0.3475
200 E B -1.8092
201 D B 0.0000
202 V B 0.4794
203 A B 0.0000
204 V B 0.1431
205 Y B 0.0000
206 Y B 0.0000
207 C B 0.0000
208 Q B 0.0000
209 Q B 0.0000
210 S B 0.0501
211 Y B 0.3803
212 S B 0.0408
213 A B 0.0239
214 P B 0.0063
215 L B 0.1436
216 T B 0.0166
217 F B 0.0000
218 G B 0.0000
219 G B -0.4751
220 G B -0.1350
221 T B 0.0000
222 K B -0.9696
223 V B 0.0000
224 E B -1.0211
225 I B 0.0505
226 K B -1.5927
Download PDB file
View in 3Dmol
Play the video

Automated mutations analysis

In the automated mutations mode, the server selects aggregation prone resides and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine. The table below shows 2 best scored mutants for each mutated residue. Protein variants are ordered according to the mutation effect they had on protein stability (energetic effect) together with the difference in the average per-residue aggregation score between the wild type and the mutant (in the table green values indicate a positive change, grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this CSV file.

Mutant
Energetic effect
Score comparison
IR116B -0.8255 -0.0065 View CSV PDB
VE109B -0.6068 -0.0055 View CSV PDB
IE116B -0.5794 -0.0054 View CSV PDB
VE114B -0.5575 -0.0053 View CSV PDB
FR117B -0.2998 -0.006 View CSV PDB
VK109B -0.8677 -0.0035 View CSV PDB
VR114B -0.2478 -0.0053 View CSV PDB
IK55A -0.0542 -0.0058 View CSV PDB
IE55A 0.0524 -0.0076 View CSV PDB
FD115B 0.2208 -0.0058 View CSV PDB
FE117B 0.321 -0.0069 View CSV PDB
FE115B 0.3248 -0.0054 View CSV PDB
 
Laboratory of Theory of Biopolymers 2018