Project name: 9d69a63df667a8

Chain sequence(s)	A: AEGDKTCPDGYEHTCGCIGGCGCKRSACIGALCCQASLGGWLSDGETYT
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:44)

• Minimal score value: -3.3787
• Maximal score value: 2.6211
• Average score: -0.612
• Total score value: -29.9864

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	A	-1.3538
2	E	A	-2.6017
3	G	A	-2.6853
4	D	A	-3.1886
5	K	A	-2.8862
6	T	A	-1.9709
7	C	A	-2.2768
8	P	A	-2.5188
9	D	A	-2.7389
10	G	A	-2.5062
11	Y	A	-3.0601
12	E	A	-3.2373
13	H	A	-2.0091
14	T	A	-0.7773
15	C	A	0.4010
16	G	A	0.2819
17	C	A	1.1158
18	I	A	1.9989
19	G	A	0.8002
20	G	A	0.8074
21	C	A	0.3801
22	G	A	0.0000
23	C	A	0.0000
24	K	A	-2.6402
25	R	A	-3.3787
26	S	A	-1.1573
27	A	A	-0.1105
28	C	A	1.6156
29	I	A	2.6211
30	G	A	1.3223
31	A	A	0.9852
32	L	A	2.0729
33	C	A	1.5321
34	C	A	1.1022
35	Q	A	0.0484
36	A	A	0.2998
37	S	A	0.0000
38	L	A	1.1618
39	G	A	-0.1768
40	G	A	-0.1791
41	W	A	-0.5939
42	L	A	0.0000
43	S	A	-1.8653
44	D	A	-2.9772
45	G	A	-1.7061
46	E	A	-1.4763
47	T	A	-0.2692
48	Y	A	1.1060
49	T	A	0.7025