Project name: IGF2 [mutate: LR13A]

Chain sequence(s)	A: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	LR13A
Energy difference between WT (input) and mutated protein (by FoldX)	10.7598 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       FoldX:    Building mutant model                                                       (00:00:39)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:01:03)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:26)

• Minimal score value: -3.1283
• Maximal score value: 1.5347
• Average score: -0.9434
• Total score value: -63.2073

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	A	A	-0.0469
2	Y	A	0.1456
3	R	A	-1.8669
4	P	A	-1.4225
5	S	A	-1.7044
6	E	A	-2.3439
7	T	A	-1.0496
8	L	A	-0.7043
9	C	A	-0.5272
10	G	A	-0.9814
11	G	A	-1.4513
12	E	A	-2.1618
13	R	A	0.0000	mutated: LR13A
14	V	A	-0.7269
15	D	A	-1.6348
16	T	A	-0.7065
17	L	A	0.0000
18	Q	A	-1.2142
19	F	A	0.7472
20	V	A	0.0621
21	C	A	0.0000
22	G	A	-1.4414
23	D	A	-2.7920
24	R	A	-3.1283
25	G	A	-1.1517
26	F	A	0.2610
27	Y	A	1.5347
28	F	A	1.3834
29	S	A	0.2248
30	R	A	-0.6992
31	P	A	-1.0724
32	A	A	-1.7065
33	S	A	-1.5965
34	R	A	-1.7026
35	V	A	-0.2656
36	S	A	-1.2741
37	R	A	-2.6799
38	R	A	-3.0175
39	S	A	-1.8478
40	R	A	-1.3061
41	G	A	-0.8216
42	I	A	0.0000
43	V	A	-0.5502
44	E	A	-1.5057
45	E	A	0.0000
46	C	A	0.0000
47	C	A	-0.2550
48	F	A	0.4771
49	R	A	-1.4907
50	S	A	-1.3327
51	C	A	0.0000
52	D	A	-1.5504
53	L	A	-0.6482
54	A	A	-0.5133
55	L	A	-0.5392
56	L	A	0.0000
57	E	A	-1.4229
58	T	A	-0.4643
59	Y	A	0.0000
60	C	A	-0.5090
61	A	A	-0.6085
62	T	A	-1.0273
63	P	A	-0.9297
64	A	A	-1.6615
65	K	A	-2.6030
66	S	A	-2.6128
67	E	A	-2.7730