Project name: CD58_6mut

Status: done

Started: 2026-07-23 07:37:24
Settings
Chain sequence(s) A: SSQQIYGVKYGNVTFHVPSNQPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTKSGSLTIYNLTSSDEDEYEMESPNITDSMKFFLYVGESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHR
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:26)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:27)
Show buried residues

Minimal score value
-3.6658
Maximal score value
0.959
Average score
-0.9724
Total score value
-181.846

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 S A -0.7026
2 S A -1.2471
3 Q A -1.8186
4 Q A -1.5472
5 I A -0.5214
6 Y A 0.2014
7 G A 0.0000
8 V A 0.0133
9 K A -0.5406
10 Y A 0.2354
11 G A -0.4472
12 N A -1.0167
13 V A -0.4564
14 T A -0.1698
15 F A 0.0000
16 H A -1.0415
17 V A 0.0000
18 P A -0.8913
19 S A -1.5448
20 N A -2.0290
21 Q A -2.1311
22 P A -2.3103
23 L A 0.0000
24 K A -3.3385
25 E A -2.9635
26 V A 0.0000
27 L A -0.8655
28 W A 0.0000
29 K A -2.6405
30 K A -2.8385
31 Q A -3.2873
32 K A -3.6658
33 D A -3.5230
34 K A -2.3763
35 V A 0.0000
36 A A 0.0000
37 E A -0.8922
38 L A 0.0000
39 E A -2.7383
40 N A -2.8185
41 S A -2.2573
42 E A -2.3861
43 F A -0.5722
44 R A -0.8196
45 A A -0.7120
46 F A -0.9580
47 S A -0.9908
48 S A -0.9392
49 F A 0.0000
50 K A -2.2657
51 N A -2.0206
52 R A -1.2869
53 V A -0.2699
54 Y A 0.9590
55 L A 0.0000
56 D A -0.7440
57 T A -1.4637
58 K A -2.5425
59 S A -1.8256
60 G A 0.0000
61 S A 0.0000
62 L A 0.0000
63 T A 0.1323
64 I A 0.0000
65 Y A -0.3721
66 N A -1.0165
67 L A 0.0000
68 T A -0.5894
69 S A -0.5412
70 S A -0.6104
71 D A 0.0000
72 E A -0.7755
73 D A -1.1235
74 E A -2.0340
75 Y A 0.0000
76 E A -1.8840
77 M A 0.0000
78 E A -1.6804
79 S A 0.0000
80 P A -1.5050
81 N A -1.9561
82 I A -0.9527
83 T A -1.1649
84 D A -2.0696
85 S A -1.3720
86 M A -1.2039
87 K A -1.7830
88 F A 0.0000
89 F A -0.9498
90 L A 0.0000
91 Y A -0.2233
92 V A 0.0000
93 G A -0.3815
94 E A -1.1685
95 S A -0.7521
96 L A 0.0000
97 P A -0.5373
98 S A -0.3419
99 P A 0.0000
100 T A -0.0644
101 L A 0.1660
102 T A 0.0924
103 C A 0.4952
104 A A 0.4727
105 L A 0.4100
106 T A -0.4842
107 N A -1.4366
108 G A -1.2897
109 S A -0.9082
110 I A 0.0000
111 E A -0.0714
112 V A 0.0000
113 Q A -0.1652
114 C A 0.0000
115 M A 0.1720
116 I A -0.5731
117 P A -1.2052
118 E A -2.4597
119 H A -2.2037
120 Y A 0.0000
121 N A -2.4248
122 S A -1.5339
123 H A -1.2378
124 R A -1.4543
125 G A -0.8694
126 L A -0.1203
127 I A 0.0000
128 M A 0.0958
129 Y A -0.1238
130 S A -1.3533
131 W A 0.0000
132 D A -2.8261
133 C A -2.0138
134 P A -1.3444
135 M A -1.6734
136 E A -2.9021
137 Q A -2.3070
138 C A 0.0000
139 K A -3.6361
140 R A -3.3948
141 N A -2.2262
142 S A -1.2890
143 T A -0.3905
144 S A -0.3781
145 I A 0.0000
146 Y A 0.5249
147 F A 0.0000
148 K A -2.0420
149 M A -1.6332
150 E A -2.9913
151 N A -3.1229
152 D A -2.8857
153 L A -1.7898
154 P A 0.0000
155 Q A -1.8420
156 K A -2.1528
157 I A 0.0000
158 Q A -1.2422
159 C A 0.0000
160 T A -0.7910
161 L A 0.0000
162 S A -0.1864
163 N A -0.2462
164 P A 0.1464
165 L A 0.3740
166 F A -0.2557
167 N A -1.0863
168 T A -0.7145
169 T A -0.6918
170 S A -0.2019
171 S A -0.5744
172 I A -0.0523
173 I A 0.0671
174 L A 0.0000
175 T A -0.0745
176 T A 0.1060
177 C A 0.0000
178 I A 0.7896
179 P A -0.0706
180 S A -0.5429
181 S A -0.8113
182 G A -1.8956
183 H A -2.5786
184 S A -3.0478
185 R A -3.5754
186 H A -3.0294
187 R A -3.4043
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018