Project name: 9dea3d3897dbad3

Status: done

Started: 2026-04-17 21:42:27
Settings
Chain sequence(s) A: GQPRPSPGARAPVLQSFQEDQFQGHWFVLGLAGSTYSRVHRALLGPFTATFEQKEKKRLEVSYAMTRGRSCITWSYVLIPAAQPGKFSVDNSREPEADAEELQVHSTDYTTFALMVSRRQSRTRARSLLRVYLLCRMWAVETQALDRFACLLRAQGLTEDNVVFPGVKENVLKD
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:46)
Show buried residues

Minimal score value
-4.04
Maximal score value
1.5081
Average score
-1.0546
Total score value
-183.4956

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
3 G A -1.2731
4 Q A -1.9242
5 P A -1.7404
6 R A -2.0153
7 P A 0.0000
8 S A -0.8838
9 P A -1.1137
10 G A -1.2896
11 A A -1.3264
12 R A -2.1834
13 A A -1.0113
14 P A -0.5950
15 V A -0.1380
16 L A -0.4407
17 Q A -1.3145
18 S A -0.8715
19 F A -1.2187
20 Q A -2.1993
21 E A -2.9570
22 D A -3.5012
23 Q A -2.3321
24 F A 0.0000
25 Q A -2.7229
26 G A -2.0045
27 H A -1.7001
28 W A 0.0000
29 F A -0.1537
30 V A 0.0000
31 L A 0.0000
32 G A 0.0000
33 L A 0.1565
34 A A 0.0000
35 G A 0.0000
36 S A -0.5368
37 T A -0.1156
38 Y A -0.6084
39 S A -1.1668
40 R A -1.6942
41 V A 0.0124
42 H A -1.2204
43 R A -1.8087
44 A A -0.5770
45 L A -0.2754
46 L A -0.3989
47 G A -0.5930
48 P A 0.2682
49 F A 0.0000
50 T A -0.1848
51 A A 0.0000
52 T A -1.0536
53 F A 0.0000
54 E A -3.6106
55 Q A -4.0400
56 K A -3.6204
57 E A -3.8657
58 K A -3.6572
59 K A -3.3126
60 R A -2.7309
61 L A 0.0000
62 E A -1.8404
63 V A 0.0000
64 S A -0.2927
65 Y A 0.3862
66 A A 0.4679
67 M A 0.0000
68 T A -0.6346
69 R A -1.9075
70 G A -1.9894
71 R A -2.5644
72 S A -1.1993
73 C A 0.2373
74 I A 1.5081
75 T A 1.0441
76 W A 0.8100
77 S A 0.0640
78 Y A 0.3528
79 V A -0.7517
80 L A 0.0000
81 I A -0.7704
82 P A -0.7773
83 A A -0.4375
84 A A -0.5129
85 Q A -1.2160
86 P A -0.9630
87 G A 0.0000
88 K A -0.6077
89 F A 0.0000
90 S A -0.6140
91 V A 0.0000
92 D A -1.2294
93 N A -1.8931
94 S A -2.2329
95 R A -3.2018
96 E A -3.4529
97 P A -2.4639
98 E A -2.9327
99 A A -2.5510
100 D A -2.1211
101 A A -1.3695
102 E A 0.0000
103 E A -1.1718
104 L A 0.0000
105 Q A 0.0000
106 V A 0.0000
107 H A 0.0000
108 S A -0.1732
109 T A -0.4713
110 D A -1.2264
111 Y A -0.9314
112 T A -0.6512
113 T A -0.8368
114 F A 0.0000
115 A A 0.0000
116 L A 0.0000
117 M A 0.0000
118 V A 0.0000
119 S A 0.0000
120 R A -1.3636
121 R A -1.7156
122 Q A -2.4435
123 S A -2.8134
124 R A -3.3941
125 T A -2.5453
126 R A -2.8816
127 A A -2.2277
128 R A -3.3662
129 S A -2.1264
130 L A -0.9855
131 L A -0.8009
132 R A -0.3717
133 V A 0.0000
134 Y A 0.0000
135 L A 0.0000
136 L A 0.0000
137 C A 0.0000
138 R A -1.7987
139 M A -0.4110
140 W A 0.2664
141 A A -0.0829
142 V A -0.7848
143 E A -2.2225
144 T A -2.0065
145 Q A -2.4833
146 A A -1.8704
147 L A -1.5771
148 D A -2.7045
149 R A -2.0981
150 F A 0.0000
151 A A -1.6126
152 C A -1.5330
153 L A 0.0000
154 L A 0.0000
155 R A -2.3814
156 A A -1.6132
157 Q A 0.0000
158 G A -1.4804
159 L A 0.0000
160 T A -1.9598
161 E A -3.0571
162 D A -2.6862
163 N A 0.0000
164 V A -1.1633
165 V A 0.0000
166 F A 0.5840
167 P A 0.0889
168 G A -0.8552
169 V A -1.0124
170 K A -2.5392
171 E A -1.9875
172 N A -0.3005
173 V A 1.0131
174 L A 0.0633
175 K A -1.4475
176 D A -2.1436
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018