Project name: obj1 [mutate: LD11C, PC14C, LI18C, AL24C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	LD11C,LI18C,AL24C,PC14C
Energy difference between WT (input) and mutated protein (by FoldX)	2.44724 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:24)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:35)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:00:59)
[INFO]       Main:     Simulation completed successfully.                                          (00:00:59)

• Minimal score value: -3.3336
• Maximal score value: 1.541
• Average score: -0.7069
• Total score value: -84.8317

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0277
2	V	C	-0.9615
3	Q	C	-1.1353
4	L	C	0.0000
5	V	C	1.1252
6	E	C	0.4836
7	S	C	-0.2935
8	G	C	-0.8235
9	G	C	-0.7012
10	G	C	-0.6933
11	D	C	-1.8277	mutated: LD11C
12	V	C	-1.4705
13	Q	C	-1.6914
14	C	C	-1.0127	mutated: PC14C
15	G	C	-1.0051
16	G	C	-1.0213
17	S	C	-1.0625
18	I	C	-1.2745	mutated: LI18C
19	R	C	-2.1145
20	L	C	0.0000
21	S	C	-0.4603
22	C	C	0.0000
23	A	C	-0.0022
24	L	C	0.0000	mutated: AL24C
25	S	C	-0.1323
26	D	C	0.0000
27	F	C	1.5410
28	T	C	0.2486
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1454
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2922
40	A	C	-0.9806
41	P	C	-1.2895
42	G	C	-1.4362
43	K	C	-2.1383
44	G	C	-1.0662
45	L	C	0.3837
46	E	C	-0.3980
47	W	C	0.3372
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5831
53	G	C	-1.2447
54	S	C	-1.2286
55	G	C	-1.0817
56	G	C	-0.7345
57	S	C	-0.3025
58	T	C	0.1989
59	Y	C	0.6077
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6175
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6722
70	I	C	0.0000
71	S	C	-0.5624
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3163
77	N	C	-1.6479
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6709
81	L	C	0.0000
82	Q	C	-1.2102
83	M	C	0.0000
84	N	C	-1.2100
85	S	C	-1.0272
86	L	C	0.0000
87	R	C	-2.1847
88	A	C	-1.7108
89	E	C	-2.3439
90	D	C	0.0000
91	T	C	-0.8328
92	A	C	0.0000
93	I	C	1.1003
94	Y	C	0.0000
95	Y	C	0.7226
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1921
101	D	C	-3.3336
102	G	C	-2.0866
103	F	C	-1.2310
104	N	C	-2.4286
105	K	C	-3.1851
106	G	C	-1.9085
107	F	C	-0.9896
108	D	C	-1.1107
109	Y	C	-0.2293
110	W	C	0.6154
111	G	C	0.1028
112	Q	C	-0.7322
113	G	C	0.2148
114	T	C	0.6581
115	L	C	1.2852
116	V	C	0.0000
117	T	C	-0.8390
118	V	C	0.0000
119	S	C	-1.2608
120	S	C	-0.8934