Project name: obj1 [mutate: VN5C, VC12C, GS9C, LW11C, GV16C]

Chain sequence(s)	C: EVQLVESGGGLVQPGGSLRLSCAASDFTFRSYEMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAIYYCARLRDGFNKGFDYWGQGTLVTVSS
Selected Chain(s)	C
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	VC12C,GS9C,LW11C,VN5C,GV16C
Energy difference between WT (input) and mutated protein (by FoldX)	8.72533 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with C chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       FoldX:    Building mutant model                                                       (00:00:29)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:37)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:04)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:04)

• Minimal score value: -3.3333
• Maximal score value: 1.7763
• Average score: -0.6942
• Total score value: -83.3032

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	E	C	-2.0234
2	V	C	-0.9522
3	Q	C	-1.8401
4	L	C	0.0000
5	N	C	-1.8306	mutated: VN5C
6	E	C	0.0000
7	S	C	-0.8438
8	G	C	-0.6745
9	S	C	0.1163	mutated: GS9C
10	G	C	0.7543
11	W	C	1.1065	mutated: LW11C
12	C	C	0.0000	mutated: VC12C
13	Q	C	-1.2133
14	P	C	-1.2243
15	G	C	-0.9629
16	V	C	-0.0616	mutated: GV16C
17	S	C	-0.6931
18	L	C	-0.6634
19	R	C	-2.0399
20	L	C	0.0000
21	S	C	-0.8558
22	C	C	0.0000
23	A	C	-1.0385
24	A	C	0.0000
25	S	C	-0.5435
26	D	C	0.0000
27	F	C	1.5423
28	T	C	0.2494
29	F	C	0.0000
30	R	C	-2.0325
31	S	C	-0.8863
32	Y	C	-1.2160
33	E	C	-1.1454
34	M	C	0.0000
35	S	C	0.0000
36	W	C	0.0000
37	V	C	0.0000
38	R	C	0.0000
39	Q	C	-0.2978
40	A	C	-0.9857
41	P	C	-1.2943
42	G	C	-1.4348
43	K	C	-2.1350
44	G	C	-1.0592
45	L	C	0.3944
46	E	C	-0.3909
47	W	C	0.3405
48	V	C	0.0000
49	S	C	0.0000
50	A	C	0.0000
51	I	C	0.0000
52	S	C	-0.5829
53	G	C	-1.2446
54	S	C	-1.2285
55	G	C	-1.0815
56	G	C	-0.7342
57	S	C	-0.3020
58	T	C	0.1991
59	Y	C	0.6078
60	Y	C	-0.3559
61	A	C	-1.1386
62	D	C	-2.3443
63	S	C	-1.7150
64	V	C	0.0000
65	K	C	-2.3847
66	G	C	-1.6179
67	R	C	0.0000
68	F	C	0.0000
69	T	C	-0.6719
70	I	C	0.0000
71	S	C	-0.5621
72	R	C	-1.3626
73	D	C	-1.9805
74	N	C	-2.1901
75	S	C	-1.7905
76	K	C	-2.3172
77	N	C	-1.6491
78	T	C	0.0000
79	L	C	0.0000
80	Y	C	-0.6475
81	L	C	0.0000
82	Q	C	-1.1892
83	M	C	0.0000
84	N	C	-1.0343
85	S	C	-0.9111
86	L	C	0.0000
87	R	C	-2.3366
88	A	C	-1.8958
89	E	C	-2.3367
90	D	C	0.0000
91	T	C	-0.4908
92	A	C	0.0000
93	I	C	1.0939
94	Y	C	0.0000
95	Y	C	0.3532
96	C	C	0.0000
97	A	C	0.0000
98	R	C	0.0000
99	L	C	0.0000
100	R	C	-3.1907
101	D	C	-3.3333
102	G	C	-2.0866
103	F	C	-1.2310
104	N	C	-2.4286
105	K	C	-3.1848
106	G	C	-1.9076
107	F	C	-0.9859
108	D	C	-1.1040
109	Y	C	-0.2190
110	W	C	0.2376
111	G	C	-0.8385
112	Q	C	-1.4829
113	G	C	-0.2861
114	T	C	0.3384
115	L	C	1.7763
116	V	C	0.0000
117	T	C	0.1715
118	V	C	0.0000
119	S	C	-0.8222
120	S	C	-1.0486