Project name: 9f723b0304c1d12

Status: done

Started: 2024-12-26 07:51:42
Settings
Chain sequence(s) P: GCGELVWVGEPLTLRTAETITGKYGVWMRDPKPTYPYTQETTWRIDTVGTDVRQVFEYDLISQFMQGYPSKVHILPRPLESTGAVVYSGSLYFQGAESRTVIRYELNTETVKAEKEIPGAGYHGQFPYSWGGYTDIDLAVDEAGLWVIYSTDEAKGAIVLSKLNPENLELEQTWETNIRKQSVANAFIICGTLYTVSSYTSADATVNFAYDTGTGISKTLTIPFKNRYKYSSMIDYNPLEKKLFAWDNLNMVTYDFKLS
input PDB
Selected Chain(s) P
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with P chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:55)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:57)
Show buried residues

Minimal score value
-3.5887
Maximal score value
1.9403
Average score
-0.5482
Total score value
-141.9774

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
244 G P -0.3820
245 C P -0.0388
246 G P -0.7491
247 E P -1.4656
248 L P 0.0000
249 V P 1.0891
250 W P 0.4543
251 V P 0.0000
252 G P -1.5532
253 E P -2.0417
254 P P -0.7264
255 L P 0.9157
256 T P 0.2340
257 L P -0.4118
258 R P -2.0167
259 T P -1.0586
260 A P -1.2468
261 E P -1.5710
262 T P -0.3233
263 I P 1.2229
264 T P 0.1399
265 G P -0.6322
266 K P -1.3091
267 Y P -0.2932
268 G P -0.1251
269 V P 0.3287
270 W P 0.0000
271 M P 0.0000
272 R P -0.6177
273 D P -0.9864
274 P P 0.0000
275 K P -1.5974
276 P P -0.6210
277 T P 0.1531
278 Y P 1.0953
279 P P 0.4747
280 Y P 0.0915
281 T P -0.5699
282 Q P -1.3747
283 E P -1.5586
284 T P -1.0193
285 T P 0.0000
286 W P -0.3213
287 R P -0.2048
288 I P 0.2313
289 D P -0.1684
290 T P 0.1621
291 V P 1.2483
292 G P 0.1080
293 T P -0.4559
294 D P -1.1706
295 V P 0.7411
296 R P 0.0000
297 Q P 0.5233
298 V P 0.0000
299 F P 0.1065
300 E P -0.5123
301 Y P 0.0000
302 D P -0.6754
303 L P 1.3568
304 I P 1.4511
305 S P 0.6796
306 Q P 0.4340
307 F P 0.0000
308 M P -0.1354
309 Q P -0.6431
310 G P -0.1963
311 Y P 0.6325
312 P P -0.1600
313 S P -0.4534
314 K P -0.9567
315 V P 0.4452
316 H P 0.0000
317 I P 1.9403
318 L P 0.0000
319 P P 0.1190
320 R P -0.7262
321 P P -0.9180
322 L P 0.0000
323 E P -0.8336
324 S P -0.2629
325 T P -0.3639
326 G P -0.3952
327 A P 0.0000
328 V P 0.0000
329 V P 0.0000
330 Y P 0.1818
331 S P -0.2954
332 G P -0.6564
333 S P 0.0000
334 L P 0.0000
335 Y P 0.0000
336 F P 0.0000
337 Q P 0.0000
338 G P 0.0000
339 A P -1.3058
340 E P -2.1122
341 S P -1.4651
342 R P -1.4005
343 T P -1.4344
344 V P 0.0000
345 I P 0.0000
346 R P 0.0000
347 Y P 0.0000
348 E P -1.6449
349 L P 0.0000
350 N P -1.8276
351 T P -1.5318
352 E P -1.5964
353 T P -1.1192
354 V P -1.2655
355 K P -2.5729
356 A P -2.4744
357 E P -2.7782
358 K P -2.4611
359 E P -1.7677
360 I P 0.0000
361 P P -0.2034
362 G P -0.5187
363 A P -0.9180
364 G P 0.0000
365 Y P -0.8164
366 H P -1.6877
367 G P -1.2910
368 Q P -0.4830
369 F P 1.3273
370 P P 1.0078
371 Y P 1.6777
372 S P 0.9775
373 W P 1.1918
374 G P 0.1646
375 G P -0.2453
376 Y P -0.2049
377 T P -0.9208
378 D P -2.1605
379 I P 0.0000
380 D P -0.8693
381 L P 0.0000
382 A P -0.2905
383 V P 0.0000
384 D P 0.0000
385 E P -0.6298
386 A P -0.4336
387 G P -0.5790
388 L P 0.0000
389 W P 0.0000
390 V P 0.0000
391 I P 0.0000
392 Y P 0.0000
393 S P -2.1630
394 T P 0.0000
395 D P -3.2978
396 E P -3.2179
397 A P 0.0000
398 K P -3.3069
399 G P -2.9478
400 A P 0.0000
401 I P -1.7013
402 V P 0.0000
403 L P 0.0000
404 S P 0.0000
405 K P -1.8120
406 L P 0.0000
407 N P -2.3018
408 P P -1.8988
409 E P -3.3346
410 N P -3.4143
411 L P 0.0000
412 E P -3.5887
413 L P -2.2014
414 E P -2.4136
415 Q P -2.1609
416 T P -1.3329
417 W P -1.1018
418 E P -1.9453
419 T P -1.4962
420 N P -2.0736
421 I P -1.8535
422 R P -3.2358
423 K P -3.2277
424 Q P -2.4031
425 S P -1.6676
426 V P -0.8598
427 A P -0.3498
428 N P 0.0000
429 A P 0.0000
430 F P 0.0000
431 I P 0.0000
432 I P 0.0000
433 C P 0.0024
434 G P 0.0000
435 T P 0.0794
436 L P 0.0000
437 Y P -0.1285
438 T P 0.0000
439 V P 0.0000
440 S P -0.2560
441 S P -0.4782
442 Y P 0.7810
443 T P 0.1588
444 S P -0.2660
445 A P -0.5541
446 D P -1.8048
447 A P -1.2147
448 T P -0.7035
449 V P 0.0000
450 N P -0.6139
451 F P -0.4926
452 A P 0.0000
453 Y P 0.0000
454 D P -0.2313
455 T P -0.3645
456 G P -0.3849
457 T P -0.0105
458 G P -0.0462
459 I P 1.1390
460 S P -0.2143
461 K P -1.2550
462 T P -0.8066
463 L P -0.0934
464 T P 0.1249
465 I P 0.4550
466 P P -0.7143
467 F P 0.0000
468 K P -2.1475
469 N P -1.6881
470 R P -1.5428
471 Y P -1.0621
472 K P -1.4192
473 Y P 0.3779
474 S P -0.1498
475 S P 0.0000
476 M P 0.0602
477 I P 0.0000
478 D P -0.3241
479 Y P 0.0000
480 N P 0.0000
481 P P -0.6297
482 L P -0.4881
483 E P -1.2210
484 K P -1.8768
485 K P -1.5543
486 L P 0.0000
487 F P -0.0225
488 A P 0.0000
489 W P -0.1354
490 D P 0.0000
491 N P -1.0291
492 L P 0.4252
493 N P -0.6299
494 M P 0.0000
495 V P 0.0000
496 T P -0.1596
497 Y P 0.0000
498 D P -2.0809
499 F P 0.0000
500 K P -1.6240
501 L P -0.3742
502 S P -0.5833
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018