Project name: 9f7b7edd5f2e789

Chain sequence(s)	A: QVQLVESGGGSVQAGGSLRLSCTASGFAFSSYLGWFRQAPGQEREAVAAWFDGTKYYADSVKGRFTISRDNAKNTVTLQMNNLKPEDTAIYYCDRGIGARRGPYYMDVWGQGTQVTVSS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:16)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:17)

• Minimal score value: -3.2252
• Maximal score value: 1.3716
• Average score: -0.7649
• Total score value: -91.0286

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	Q	A	-1.4520
2	V	A	-1.0345
3	Q	A	-1.0057
4	L	A	0.0000
5	V	A	0.9189
6	E	A	0.0468
7	S	A	-0.6953
8	G	A	-1.2903
9	G	A	-1.2055
10	G	A	-0.9477
11	S	A	-0.7301
12	V	A	-0.8593
13	Q	A	-1.8022
14	A	A	-1.9380
15	G	A	-1.8376
16	G	A	-1.3914
17	S	A	-1.4380
18	L	A	-1.2019
19	R	A	-2.1130
20	L	A	0.0000
21	S	A	-0.5388
22	C	A	0.0000
23	T	A	-0.1781
24	A	A	0.0000
25	S	A	-0.6537
26	G	A	-0.7960
27	F	A	0.0139
28	A	A	0.3862
29	F	A	0.3946
30	S	A	0.4567
31	S	A	-0.0577
32	Y	A	0.4710
33	L	A	0.0000
34	G	A	0.0000
35	W	A	0.0000
36	F	A	-0.1602
37	R	A	0.0000
38	Q	A	-1.6721
39	A	A	-1.6959
40	P	A	-1.1720
41	G	A	-1.6609
42	Q	A	-2.7799
43	E	A	-3.2252
44	R	A	-2.4210
45	E	A	-2.0938
46	A	A	-0.4422
47	V	A	0.0000
48	A	A	0.0000
49	A	A	0.3533
50	W	A	-0.1025
51	F	A	-0.3158
52	D	A	-1.8108
53	G	A	-1.3648
54	T	A	-0.7145
55	K	A	-0.4539
56	Y	A	0.5317
57	Y	A	-0.4207
58	A	A	-1.1506
59	D	A	-2.3409
60	S	A	-1.7331
61	V	A	0.0000
62	K	A	-2.4489
63	G	A	-1.8611
64	R	A	-1.7597
65	F	A	0.0000
66	T	A	-0.7726
67	I	A	0.0000
68	S	A	-0.7293
69	R	A	-1.3800
70	D	A	-1.9012
71	N	A	-2.1061
72	A	A	-1.6002
73	K	A	-2.4095
74	N	A	-1.6384
75	T	A	-1.1236
76	V	A	0.0000
77	T	A	-0.8105
78	L	A	0.0000
79	Q	A	-1.1475
80	M	A	0.0000
81	N	A	-1.8217
82	N	A	-2.2886
83	L	A	0.0000
84	K	A	-2.6204
85	P	A	-1.9127
86	E	A	-2.3249
87	D	A	0.0000
88	T	A	-1.1207
89	A	A	0.0000
90	I	A	-0.3209
91	Y	A	0.0000
92	Y	A	-0.1018
93	C	A	0.0000
94	D	A	0.0000
95	R	A	0.0000
96	G	A	0.0000
97	I	A	1.0423
98	G	A	-0.3131
99	A	A	-0.7607
100	R	A	-2.5136
101	R	A	-2.1910
102	G	A	-1.0687
103	P	A	0.1344
104	Y	A	1.3716
105	Y	A	1.0774
106	M	A	0.7956
107	D	A	-0.5573
108	V	A	-0.2875
109	W	A	-0.0780
110	G	A	-0.1302
111	Q	A	-0.8591
112	G	A	0.0000
113	T	A	-0.7175
114	Q	A	-1.2617
115	V	A	0.0000
116	T	A	-1.0047
117	V	A	0.0000
118	S	A	-1.2634
119	S	A	-0.9186