Project name: 07_rank

Status: done

Started: 2026-04-28 14:22:00
Settings
Chain sequence(s) B: TPQEKHNRYVEEQKWWMERFLKDQGEETYEIYLPAYRKRVEESKKDPKVPPTIPWVDP
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:46)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:47)
Show buried residues

Minimal score value
-4.2325
Maximal score value
1.0939
Average score
-1.8362
Total score value
-106.4997

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 T B -1.4328
2 P B -1.9155
3 Q B -2.8288
4 E B -3.2035
5 K B -3.4493
6 H B -2.8414
7 N B -3.6652
8 R B -3.8756
9 Y B -2.0854
10 V B 0.0000
11 E B -3.8441
12 E B -2.7853
13 Q B -1.8777
14 K B -2.2792
15 W B -0.5070
16 W B 0.3140
17 M B -0.3729
18 E B -0.8695
19 R B -1.1451
20 F B -0.0706
21 L B 0.0000
22 K B -3.2832
23 D B -2.8968
24 Q B -2.6243
25 G B -2.9166
26 E B -3.8836
27 E B -3.4104
28 T B -2.2439
29 Y B -2.6165
30 E B -2.6718
31 I B -1.0871
32 Y B -0.5290
33 L B -1.4231
34 P B -1.2501
35 A B -0.9818
36 Y B 0.0000
37 R B -3.5872
38 K B -3.6255
39 R B -2.9893
40 V B 0.0000
41 E B -4.2325
42 E B -3.4834
43 S B 0.0000
44 K B -3.3952
45 K B -3.2086
46 D B -2.6323
47 P B -2.2173
48 K B -2.2437
49 V B -1.5721
50 P B -0.8257
51 P B -1.5003
52 T B 0.0743
53 I B 0.5791
54 P B 0.2999
55 W B 1.0939
56 V B 0.1327
57 D B -1.4022
58 P B -1.2112
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018