Project name: L12

Status: done

Started: 2024-12-06 06:53:25
Settings
Chain sequence(s) A: DITDGNSEHLKREHSLIKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQPCFLKDWEMHVHFKVHGTGKKNLHGDGIALWYTRDRLVPGPVFGSKDNFHGLAIFLDTYPNDETTERVFPYISVMVNNGSLSYDHSKDGRWTELAGCTADFRNRDHDTFLAVRYSRGRLTVMTDLEDKNEWKNCIDITGVRLPTGYYFGASAGTGDLSDNHDIISMKLFQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:38)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:40)
Show buried residues

Aggrescan3D profile | L12 | Chain AD45S69D93K125E168T197E231D261-4-2024ResidueScore
Minimal score value
-4.4314
Maximal score value
1.3962
Average score
-0.7613
Total score value
-175.8706

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

Show chain Show residues from to
residue index residue name chain Aggrescan3D score mutation
residue index
residue name
chain
Aggrescan3D score
mutation
45 D A -1.7748
46 I A -0.8295
47 T A -1.7364
48 D A -2.5073
49 G A -2.2243
50 N A -2.8674
51 S A -2.5614
52 E A -2.9821
53 H A -2.8650
54 L A -2.3795
55 K A -2.2695
56 R A -2.3145
57 E A -2.1049
58 H A 0.0000
59 S A 0.0000
60 L A 0.0000
61 I A -0.3262
62 K A -0.9847
63 P A -1.0009
64 Y A 0.0000
65 Q A -0.9912
66 G A -0.2129
67 V A 0.0722
68 G A -0.5349
69 S A -0.4656
70 S A -0.2758
71 S A -0.0258
72 M A 0.7682
73 P A -0.0039
74 L A -0.5278
75 W A 0.0000
76 D A -0.2345
77 F A 0.2899
78 Q A -0.3230
79 G A -0.9300
80 S A -0.8706
81 T A -0.2662
82 M A 0.6607
83 L A 0.6227
84 T A -0.1503
85 S A -0.8142
86 Q A -1.2028
87 Y A -0.2356
88 V A 0.0000
89 R A -0.0186
90 L A 0.0000
91 T A 0.0000
92 P A -1.5021
93 D A -1.8996
94 E A -3.1552
95 R A -3.7955
96 S A -2.6591
97 K A -2.7935
98 E A -2.6069
99 G A 0.0000
100 S A 0.0000
101 I A 0.0000
102 W A 0.0000
103 N A 0.0000
104 H A -0.8971
105 Q A -1.0085
106 P A -0.4235
107 C A 0.0000
108 F A 1.3962
109 L A -0.1347
110 K A -1.8184
111 D A -1.7851
112 W A 0.0000
113 E A 0.0000
114 M A 0.0000
115 H A -0.3427
116 V A 0.0000
117 H A -0.2854
118 F A 0.0000
119 K A -1.2956
120 V A 0.0000
121 H A -1.2205
122 G A -0.9904
123 T A -0.9021
124 G A -1.2463
125 K A -2.4779
126 K A -2.6842
127 N A -1.6184
128 L A -0.3748
129 H A 0.0000
130 G A 0.0000
131 D A -0.4791
132 G A 0.0000
133 I A 0.0000
134 A A 0.0000
135 L A 0.0000
136 W A 0.0000
137 Y A 0.0000
138 T A 0.0000
139 R A -2.0490
140 D A -1.0567
141 R A -0.4396
142 L A 0.5595
143 V A 0.7971
144 P A -0.2889
145 G A -0.5883
146 P A -0.8735
147 V A 0.0000
148 F A 0.0000
149 G A 0.0000
150 S A 0.0000
151 K A -0.5213
152 D A -0.8775
153 N A -1.2486
154 F A 0.0000
155 H A -1.4699
156 G A 0.0000
157 L A 0.0000
158 A A 0.0000
159 I A 0.0000
160 F A 0.0000
161 L A 0.0000
162 D A 0.0000
163 T A 0.0000
164 Y A 0.3924
165 P A -0.7356
166 N A -1.3200
167 D A 0.0000
168 E A -2.3403
169 T A -1.5720
170 T A -1.4752
171 E A -1.7577
172 R A -0.2214
173 V A 1.2495
174 F A 0.5179
175 P A 0.0000
176 Y A 0.3894
177 I A 0.0000
178 S A 0.0000
179 V A 0.0000
180 M A 0.0000
181 V A 0.0237
182 N A 0.0000
183 N A -1.5822
184 G A -1.2713
185 S A -0.6591
186 L A 0.0131
187 S A -0.3497
188 Y A 0.0000
189 D A -0.8680
190 H A -1.0316
191 S A -1.1611
192 K A -1.2200
193 D A 0.0000
194 G A 0.0000
195 R A -0.2359
196 W A 0.8340
197 T A 0.4695
198 E A 0.2171
199 L A 0.9575
200 A A 0.1317
201 G A -0.1368
202 C A 0.1889
203 T A 0.2327
204 A A 0.0000
205 D A -1.7561
206 F A 0.0000
207 R A -1.6228
208 N A -2.3485
209 R A -2.8865
210 D A -3.0881
211 H A -2.8621
212 D A -3.0570
213 T A 0.0000
214 F A -0.6181
215 L A 0.0000
216 A A 0.0000
217 V A 0.0000
218 R A -0.8575
219 Y A 0.0000
220 S A -2.2834
221 R A -3.0001
222 G A -2.5483
223 R A -2.6549
224 L A 0.0000
225 T A 0.0000
226 V A 0.0000
227 M A 0.0000
228 T A 0.0000
229 D A 0.0000
230 L A 0.0000
231 E A -3.7676
232 D A -4.4314
233 K A -4.2576
234 N A -3.9140
235 E A -3.8313
236 W A -2.0930
237 K A -2.8017
238 N A -2.3103
239 C A -1.1370
240 I A 0.0000
241 D A -1.8394
242 I A -0.7018
243 T A -1.5041
244 G A -1.4638
245 V A -1.3964
246 R A -2.3382
247 L A 0.0000
248 P A -0.7350
249 T A -0.1733
250 G A -0.0337
251 Y A 0.0000
252 Y A -0.4499
253 F A 0.0000
254 G A 0.0000
255 A A 0.0000
256 S A 0.0000
257 A A 0.0000
258 G A 0.0000
259 T A 0.0000
260 G A -2.3275
261 D A -2.5740
262 L A -1.4554
263 S A -1.6690
264 D A 0.0000
265 N A -0.9749
266 H A 0.0000
267 D A 0.0000
268 I A 0.0000
269 I A -0.2667
270 S A 0.0000
271 M A 0.0000
272 K A -0.9811
273 L A 0.0000
274 F A 0.0000
275 Q A -2.0831
residue index residue name chain Aggrescan3D score
mutation
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018