Project name: Mb5-11_VIFFLF

Status: done

Started: 2026-07-06 06:33:23
Settings
Chain sequence(s) A: MQANSGSLEVVEASPTSLQVSWDAFHRYHNGFTHPVRYYRITYGETGGNSPVQEFTVPGSKSTATFSGLKPGVDYTFTVYAVTWYPRYGYGESGPLSFNYRTELDKPSQ
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:03)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:04)
Show buried residues

Minimal score value
-2.8345
Maximal score value
1.4876
Average score
-0.7468
Total score value
-81.4051

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A 0.4081
2 Q A -0.9481
3 A A -1.0814
4 N A -1.8149
5 S A -1.2428
6 G A -1.5477
7 S A -1.2452
8 L A 0.0000
9 E A -1.7763
10 V A -0.3475
11 V A 0.2118
12 E A -1.3082
13 A A -0.9878
14 S A -1.2662
15 P A -1.8407
16 T A -1.2339
17 S A -1.1410
18 L A 0.0000
19 Q A -0.7167
20 V A 0.0000
21 S A -1.1146
22 W A 0.0000
23 D A -2.5671
24 A A -1.5581
25 F A 0.0000
26 H A -1.1491
27 R A 0.0000
28 Y A 0.9736
29 H A 0.2677
30 N A -0.5960
31 G A 0.1207
32 F A 1.4876
33 T A 0.7214
34 H A 0.0089
35 P A -0.4633
36 V A -1.0223
37 R A -1.5570
38 Y A -0.8457
39 Y A 0.0000
40 R A -0.8406
41 I A 0.0000
42 T A -0.6153
43 Y A -0.3609
44 G A 0.0000
45 E A -1.7690
46 T A -1.4337
47 G A -1.3540
48 G A -1.4406
49 N A -1.5389
50 S A -0.9312
51 P A -0.4131
52 V A 0.3003
53 Q A -1.1781
54 E A -1.7829
55 F A -0.6694
56 T A -0.1730
57 V A -0.3637
58 P A -0.8920
59 G A -1.1805
60 S A -1.1437
61 K A -1.7289
62 S A -1.1746
63 T A -0.7710
64 A A 0.0000
65 T A -0.3052
66 F A 0.0000
67 S A -0.7607
68 G A -1.0055
69 L A 0.0000
70 K A -2.5218
71 P A -2.1144
72 G A -1.4227
73 V A -1.4935
74 D A -2.7593
75 Y A 0.0000
76 T A -0.8565
77 F A 0.0000
78 T A 0.0000
79 V A 0.0000
80 Y A -0.2957
81 A A 0.0000
82 V A 0.0000
83 T A 0.0000
84 W A 0.4826
85 Y A 0.0000
86 P A -0.4654
87 R A -1.1066
88 Y A 0.7067
89 G A 0.7056
90 Y A 1.0964
91 G A 0.3032
92 E A -0.6917
93 S A 0.0000
94 G A -0.7499
95 P A -0.4532
96 L A -0.2040
97 S A -0.2829
98 F A -0.5493
99 N A -1.6449
100 Y A -1.4308
101 R A -2.3957
102 T A 0.0000
103 E A -2.5077
104 L A -1.3324
105 D A -2.7878
106 K A -2.8345
107 P A -1.8064
108 S A -1.6351
109 Q A -1.6594
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018