Project name: capmab

Status: done

Started: 2026-03-19 11:49:33
Settings
Chain sequence(s) A: EVQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKGRELVAAISRTGGSTYYPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAAAGVRAEDGRVRTLPSEYTFWGQGTQVTVSS
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:44)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:45)
Show buried residues

Minimal score value
-3.6747
Maximal score value
1.1541
Average score
-0.8302
Total score value
-106.2595

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 E A -2.5458
2 V A 0.0000
3 Q A -1.5678
4 L A 0.0000
5 V A 1.1211
6 E A 0.1571
7 S A -0.5225
8 G A -1.1997
9 G A -0.8411
10 G A -0.1038
11 L A 0.9361
12 V A 0.0000
13 Q A -1.3594
14 P A -1.5597
15 G A -1.3558
16 G A -1.0199
17 S A -1.5349
18 L A -1.1504
19 R A -2.3599
20 L A 0.0000
21 S A -0.4314
22 C A 0.0000
23 A A -0.1840
24 A A 0.0000
25 S A -1.4691
26 G A -2.2305
27 R A -2.4430
28 T A -1.2212
29 F A 0.0000
30 S A -0.8607
31 Y A -0.6567
32 N A 0.0000
33 P A 0.0000
34 M A 0.0000
35 G A 0.0000
36 W A 0.0000
37 F A 0.0000
38 R A 0.0000
39 Q A -1.6591
40 A A -1.6349
41 P A -1.2102
42 G A -1.6851
43 K A -2.6713
44 G A -2.1973
45 R A -2.0571
46 E A -1.1809
47 L A -0.0006
48 V A 0.0000
49 A A 0.0000
50 A A 0.0000
51 I A 0.0000
52 S A 0.0000
53 R A -1.8653
54 T A -1.5300
55 G A -1.2215
56 G A -1.2920
57 S A -0.9609
58 T A -0.1004
59 Y A 0.1290
60 Y A -0.6670
61 P A -1.3172
62 D A -2.5568
63 S A -1.8575
64 V A 0.0000
65 E A -2.7294
66 G A -1.9768
67 R A -1.9478
68 F A 0.0000
69 T A -1.0456
70 I A 0.0000
71 S A -0.4946
72 R A -1.0670
73 D A -1.5402
74 N A -1.6810
75 A A -1.4585
76 K A -2.4379
77 R A -2.1835
78 M A -1.0393
79 V A 0.0000
80 Y A -0.6155
81 L A 0.0000
82 Q A -1.7791
83 M A 0.0000
84 N A -2.1463
85 S A -1.4710
86 L A 0.0000
87 R A -2.3674
88 A A -1.7281
89 E A -2.2554
90 D A 0.0000
91 T A -0.8762
92 A A 0.0000
93 V A -0.4263
94 Y A 0.0000
95 Y A -0.2104
96 C A 0.0000
97 A A 0.0000
98 A A 0.0000
99 A A 0.0000
100 G A 0.1787
101 V A 0.5599
102 R A -1.6930
103 A A -2.2103
104 E A -3.4382
105 D A -3.6747
106 G A -2.6926
107 R A -3.1655
108 V A -0.9440
109 R A -0.1099
110 T A 0.6469
111 L A 1.1541
112 P A 0.0304
113 S A -0.1710
114 E A -0.2096
115 Y A 0.0000
116 T A 0.1012
117 F A -0.2332
118 W A 0.1208
119 G A -0.1719
120 Q A -0.8867
121 G A -0.5477
122 T A -0.7097
123 Q A -0.9966
124 V A 0.0000
125 T A -0.3342
126 V A 0.0000
127 S A -0.7577
128 S A -0.6886
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018