Project name: a0ee848d91425da

Status: done

Started: 2026-06-08 13:58:39
Settings
Chain sequence(s) A: RAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:06)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:06)
Show buried residues

Minimal score value
-3.8298
Maximal score value
1.6059
Average score
-1.3463
Total score value
-146.7463

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
18 R A -1.5026
19 A A -0.3788
20 A A 0.0391
21 T A 0.4298
22 V A 1.5987
23 G A 0.5424
24 S A 0.7790
25 L A 1.6059
26 A A 0.4275
27 G A -0.5401
28 Q A -1.2143
29 P A -1.3630
30 L A -0.5105
31 Q A -2.0080
32 E A -3.1419
33 R A -2.9544
34 A A -2.0249
35 Q A -2.2391
36 A A -1.8211
37 W A -1.0210
38 G A -1.3337
39 E A -2.8129
40 R A -3.1004
41 L A -2.1376
42 R A -3.3867
43 A A -2.9529
44 R A -2.7654
45 M A -1.6991
46 E A -3.4825
47 E A -3.5278
48 M A -1.9423
49 G A -1.8811
50 S A -2.5450
51 R A -3.4372
52 T A -3.2010
53 R A -3.8298
54 D A -3.8063
55 R A -3.5200
56 L A -1.5850
57 D A -2.9276
58 E A -2.2994
59 V A -0.6820
60 K A -1.8463
61 E A -2.3922
62 Q A -2.1973
63 V A -1.4059
64 A A -1.5556
65 E A -2.3896
66 V A -2.4432
67 R A -2.7772
68 A A -2.5391
69 K A -3.5049
70 L A 0.0000
71 E A -3.7550
72 E A -3.4173
73 Q A -2.3062
74 A A -1.7396
75 Q A -2.0189
76 Q A -1.5278
77 I A 0.1738
78 R A -1.3345
79 L A -0.3588
80 Q A -0.7725
81 A A -0.9002
82 E A -1.9061
83 A A -0.5978
84 F A -0.2503
85 Q A -1.4736
86 A A -1.0185
87 R A -0.4554
88 L A -0.1987
89 K A -1.1675
90 S A -0.5453
91 W A 0.3479
92 F A 0.8596
93 E A -0.9335
94 P A -0.3447
95 L A 0.5252
96 V A 0.3085
97 E A -1.2210
98 D A 0.0000
99 M A -0.3651
100 Q A -2.0400
101 R A -2.3784
102 Q A -0.9935
103 W A -0.1370
104 A A -0.4065
105 G A -0.6129
106 L A 0.2936
107 V A 1.3146
108 E A -0.6235
109 K A -0.4278
110 V A 0.5098
111 Q A -0.9664
112 A A -0.1240
113 A A 0.2091
114 V A 0.2996
115 G A -0.1717
116 T A -0.5215
117 S A -1.0448
118 A A -0.8731
119 A A -0.2878
120 P A -0.6638
121 V A -1.2686
122 P A -1.9063
123 S A -2.6784
124 D A -2.8842
125 N A -2.7224
126 H A -2.0428
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018