Project name: a160fc44803c167

Status: done

Started: 2026-06-22 16:04:29
Settings
Chain sequence(s) B: MEELMKAKEDFKKEKSELEKLDPVEQMKELTKKAKEIKELVEKIKEKLEA
input PDB
Selected Chain(s) B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with B chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:36)
Show buried residues

Minimal score value
-4.3925
Maximal score value
0.4676
Average score
-2.595
Total score value
-129.748

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M B -0.1311
2 E B -2.0929
3 E B -2.1225
4 L B -1.5604
5 M B -1.1572
6 K B -2.9638
7 A B -2.4530
8 K B -2.8393
9 E B -3.7530
10 D B -3.1420
11 F B -2.9533
12 K B -4.2498
13 K B -4.2237
14 E B -4.0495
15 K B -3.9684
16 S B -3.4826
17 E B -3.9570
18 L B 0.0000
19 E B -3.9346
20 K B -3.5207
21 L B -2.1758
22 D B -2.0557
23 P B -1.0603
24 V B 0.4676
25 E B -1.6062
26 Q B -2.0133
27 M B -0.3452
28 K B -2.1595
29 E B -2.1323
30 L B -1.4329
31 T B -2.0563
32 K B -3.2453
33 K B -2.7799
34 A B -2.4969
35 K B -3.6055
36 E B -3.4379
37 I B -2.7368
38 K B -3.6531
39 E B -3.4926
40 L B -2.5710
41 V B -2.6755
42 E B -4.2315
43 K B -4.2075
44 I B 0.0000
45 K B -3.7146
46 E B -4.3925
47 K B -3.4567
48 L B -1.5846
49 E B -2.7399
50 A B -1.6015
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018