Project name: a1bad6715270bd6

Chain sequence(s)	A: MQVQLVESGGGSVQAGGSLRLSCTASGTKELKYAAFDLGWFRQAPGQEREAVAAIDRDGGITYYADSVKGRFTISRDNAKNTVTLQMNNLKPVDTAIYYCAARRSRNRTYESWGQGTQVTVSGGGGSHHHHHHLEVSGWRLFKKIS
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:23)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:23)

• Minimal score value: -3.4913
• Maximal score value: 1.2678
• Average score: -0.972
• Total score value: -141.9166

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.1213
2	Q	A	-1.2338
3	V	A	-0.9436
4	Q	A	-1.2448
5	L	A	0.0000
6	V	A	0.6989
7	E	A	0.0000
8	S	A	-0.5948
9	G	A	-1.2691
10	G	A	-1.1789
11	G	A	-0.9384
12	S	A	-0.7664
13	V	A	-0.9657
14	Q	A	-2.0785
15	A	A	-1.8723
16	G	A	-1.9845
17	G	A	-1.4596
18	S	A	-1.4707
19	L	A	-1.2009
20	R	A	-2.1275
21	L	A	0.0000
22	S	A	-0.5576
23	C	A	0.0000
24	T	A	-0.3520
25	A	A	-0.5945
26	S	A	-0.8813
27	G	A	-1.4396
28	T	A	-1.8830
29	K	A	-2.9317
30	E	A	-2.8810
31	L	A	-1.9239
32	K	A	-2.4988
33	Y	A	0.0000
34	A	A	-1.8209
35	A	A	-1.7520
36	F	A	0.0000
37	D	A	-1.5604
38	L	A	0.0000
39	G	A	0.0000
40	W	A	0.0000
41	F	A	-0.3273
42	R	A	0.0000
43	Q	A	-2.1051
44	A	A	-1.3194
45	P	A	-1.2642
46	G	A	-1.7355
47	Q	A	-2.9191
48	E	A	-3.4913
49	R	A	-2.9688
50	E	A	-2.2778
51	A	A	-0.5419
52	V	A	0.0000
53	A	A	0.0000
54	A	A	0.5655
55	I	A	0.0000
56	D	A	-1.1694
57	R	A	-2.5155
58	D	A	-2.5785
59	G	A	-1.4398
60	G	A	-0.5000
61	I	A	1.2678
62	T	A	1.1420
63	Y	A	0.9544
64	Y	A	-0.4303
65	A	A	-1.1557
66	D	A	-2.3289
67	S	A	-1.2927
68	V	A	0.0000
69	K	A	-2.4797
70	G	A	-1.8581
71	R	A	-1.5892
72	F	A	0.0000
73	T	A	-0.7111
74	I	A	0.0000
75	S	A	-0.5901
76	R	A	-1.5456
77	D	A	-1.7898
78	N	A	-2.2421
79	A	A	-1.3363
80	K	A	-2.2716
81	N	A	-1.8815
82	T	A	-1.0756
83	V	A	0.0000
84	T	A	-0.7648
85	L	A	0.0000
86	Q	A	-1.1384
87	M	A	0.0000
88	N	A	-1.8436
89	N	A	-2.3332
90	L	A	0.0000
91	K	A	-1.7395
92	P	A	-0.4153
93	V	A	1.1597
94	D	A	0.0000
95	T	A	-0.0357
96	A	A	0.0000
97	I	A	-0.5193
98	Y	A	0.0000
99	Y	A	-0.1817
100	C	A	0.0000
101	A	A	0.0000
102	A	A	0.0000
103	R	A	-2.2420
104	R	A	-2.5965
105	S	A	-2.2662
106	R	A	-2.7823
107	N	A	-2.7076
108	R	A	-2.7993
109	T	A	-1.8920
110	Y	A	-1.4395
111	E	A	-2.3467
112	S	A	0.0000
113	W	A	-0.3984
114	G	A	-0.2152
115	Q	A	-0.8945
116	G	A	0.0000
117	T	A	-0.7096
118	Q	A	-1.2850
119	V	A	0.0000
120	T	A	-0.6448
121	V	A	0.0000
122	S	A	-1.1791
123	G	A	-1.3979
124	G	A	-1.6795
125	G	A	-1.4740
126	G	A	-1.4532
127	S	A	-1.5840
128	H	A	-2.2525
129	H	A	-2.5326
130	H	A	-2.7408
131	H	A	-2.4775
132	H	A	-2.1959
133	H	A	-1.4752
134	L	A	0.2703
135	E	A	-0.8230
136	V	A	1.1945
137	S	A	0.1583
138	G	A	-0.0928
139	W	A	1.0384
140	R	A	-0.3825
141	L	A	1.1053
142	F	A	1.2641
143	K	A	-0.8367
144	K	A	-0.8437
145	I	A	0.8709
146	S	A	0.0221