Project name: a1cbcdfb6d97991

Status: done

Started: 2026-04-28 06:32:33
Settings
Chain sequence(s) A: MDKDCEMKRTTLDSPLGKLELSGCEQGLHRIIFLGKGTSAADAVEVPAPAAVLGGPEPLIQATAWLNAYFHQPEAIEEFPVPALHHPVFQQESFTRQVLWKLLKVVKFGEVISESHLAALVGNPAATAAVNTALDGNPVPILIPCHRVVQGDSDVGPYLGGLAVKEWLLAHEGHRLGKPGLG
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:08)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:08)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:08)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:08)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:08)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:02:45)
[INFO]       Main:     Simulation completed successfully.                                          (00:02:47)
Show buried residues

Minimal score value
-3.3085
Maximal score value
1.5192
Average score
-0.7387
Total score value
-134.4482

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 M A -0.6776
2 D A -2.5285
3 K A -3.3085
4 D A -3.1673
5 C A -2.7084
6 E A -2.8707
7 M A -1.9561
8 K A -2.3832
9 R A -2.4697
10 T A -1.0363
11 T A -1.0681
12 L A 0.0000
13 D A -2.4210
14 S A 0.0000
15 P A -0.8384
16 L A 0.0000
17 G A -1.3955
18 K A -1.7593
19 L A 0.0000
20 E A -0.9998
21 L A 0.0000
22 S A -1.2906
23 G A 0.0000
24 C A 0.0000
25 E A -3.1976
26 Q A -2.6510
27 G A 0.0000
28 L A 0.0000
29 H A -0.8775
30 R A -0.8517
31 I A 0.0000
32 I A 0.5808
33 F A 0.1156
34 L A -0.4416
35 G A -1.1626
36 K A -1.9312
37 G A -1.0540
38 T A -1.2265
39 S A -0.9033
40 A A -0.4376
41 A A -0.6159
42 D A -1.4758
43 A A -0.3723
44 V A 0.4905
45 E A -1.1939
46 V A -0.4442
47 P A -0.5706
48 A A -0.6132
49 P A -0.4680
50 A A 0.0660
51 A A 0.7177
52 V A 0.7073
53 L A 1.5192
54 G A -0.1581
55 G A -1.1540
56 P A 0.0000
57 E A -2.3743
58 P A 0.0000
59 L A 0.0000
60 I A 0.0578
61 Q A -0.1621
62 A A 0.0000
63 T A 0.0000
64 A A 0.2650
65 W A 0.0000
66 L A 0.0000
67 N A -0.7996
68 A A 0.0000
69 Y A 0.0000
70 F A 0.0000
71 H A -1.4211
72 Q A -1.8918
73 P A -2.0241
74 E A -2.7310
75 A A -2.2652
76 I A 0.0000
77 E A -2.7895
78 E A -2.5280
79 F A -0.6176
80 P A -0.1394
81 V A 0.8289
82 P A 0.0000
83 A A -0.4576
84 L A -0.2452
85 H A -1.0449
86 H A -0.8694
87 P A -0.8295
88 V A -0.9492
89 F A 0.0000
90 Q A -2.0321
91 Q A -2.5601
92 E A -2.6573
93 S A -1.2755
94 F A -0.1755
95 T A -0.7338
96 R A -1.1882
97 Q A -0.7272
98 V A 0.0000
99 L A 0.0000
100 W A -0.2453
101 K A -0.4220
102 L A 0.0000
103 L A -0.4235
104 K A -1.3052
105 V A -0.0946
106 V A 0.0000
107 K A -1.4918
108 F A -0.9257
109 G A -0.8798
110 E A -1.1682
111 V A 0.1037
112 I A 0.0000
113 S A -1.0302
114 E A -0.8855
115 S A -1.0563
116 H A -1.0359
117 L A 0.0000
118 A A 0.0000
119 A A -0.6128
120 L A -0.0066
121 V A -0.2208
122 G A -0.7544
123 N A -1.0887
124 P A -0.8739
125 A A -0.5045
126 A A -0.4448
127 T A -0.7165
128 A A -0.2822
129 A A -0.4317
130 V A 0.0000
131 N A -1.5796
132 T A -1.1920
133 A A 0.0000
134 L A 0.0000
135 D A -2.0678
136 G A -1.3297
137 N A 0.0000
138 P A 0.0000
139 V A 0.0000
140 P A 0.0000
141 I A 0.0000
142 L A 0.0000
143 I A 0.0000
144 P A 0.0000
145 C A 0.0000
146 H A 0.0000
147 R A 0.0000
148 V A 0.0000
149 V A -0.9849
150 Q A -2.1167
151 G A -2.1771
152 D A -2.5287
153 S A -1.9314
154 D A -2.0503
155 V A -0.9511
156 G A -0.8358
157 P A -0.4296
158 Y A 0.0000
159 L A 0.4952
160 G A 0.2860
161 G A 0.0227
162 L A 0.6543
163 A A -0.1534
164 V A 0.0000
165 K A 0.0000
166 E A -0.6686
167 W A -0.3781
168 L A 0.0000
169 L A 0.0000
170 A A -0.9190
171 H A -0.6480
172 E A 0.0000
173 G A -1.1674
174 H A -1.5029
175 R A -2.3231
176 L A -1.5843
177 G A -1.8517
178 K A -2.0322
179 P A -1.0982
180 G A -0.6086
181 L A 0.7097
182 G A 0.1113
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018