Project name: a26a4ed567a67e

Status: done

Started: 2026-05-23 17:13:58
Settings
Chain sequence(s) A: APVPVTKLVCDGDTYKCTAYLDYGDGKWVAQWDTAVFHTT
C: APVPVTKLVCDGDTYKCTAYLDYGDGKWVAQWDTAVFHTT
B: APVPVTKLVCDGDTYKCTAYLDYGDGKWVAQWDTAVFHTT
input PDB
Selected Chain(s) A,C,B
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with all chain(s) selected           (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:01:07)
[INFO]       Main:     Simulation completed successfully.                                          (00:01:08)
Show buried residues

Minimal score value
-2.5598
Maximal score value
0.5675
Average score
-0.7041
Total score value
-84.4942

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 A A -0.2663
2 P A -0.5212
3 V A -0.1044
4 P A -0.6980
5 V A -0.5958
6 T A -1.0137
7 K A -1.5636
8 L A -0.3037
9 V A -0.3872
10 C A 0.0000
11 D A -0.8958
12 G A -0.7383
13 D A -1.8425
14 T A -1.1730
15 Y A -0.6498
16 K A -1.6054
17 C A 0.0000
18 T A -0.4515
19 A A 0.0000
20 Y A -0.3432
21 L A 0.0000
22 D A -1.9075
23 Y A -0.3385
24 G A -1.3295
25 D A -2.4041
26 G A -1.8453
27 K A -1.6818
28 W A -0.5161
29 V A 0.0000
30 A A 0.0000
31 Q A -0.5117
32 W A -1.2234
33 D A -1.8574
34 T A 0.0000
35 A A -0.1778
36 V A 0.1339
37 F A 0.5675
38 H A -0.6552
39 T A -0.5147
40 T A -0.4566
1 A B -0.2876
2 P B -0.5689
3 V B -0.1703
4 P B -0.6643
5 V B -0.5672
6 T B -1.0348
7 K B -1.5711
8 L B -0.3285
9 V B -0.4312
10 C B 0.0000
11 D B -0.9597
12 G B -0.8071
13 D B -1.8825
14 T B -1.2394
15 Y B -0.7882
16 K B -1.6634
17 C B 0.0000
18 T B -0.4779
19 A B 0.0000
20 Y B -0.4626
21 L B 0.0000
22 D B -2.0196
23 Y B -0.4354
24 G B -1.4313
25 D B -2.5598
26 G B -2.1135
27 K B -2.2500
28 W B -0.8461
29 V B 0.0000
30 A B 0.0000
31 Q B -0.5181
32 W B -1.2396
33 D B -1.8973
34 T B 0.0000
35 A B -0.2150
36 V B 0.0970
37 F B 0.5307
38 H B -0.6889
39 T B -0.5329
40 T B -0.4660
1 A C -0.2461
2 P C -0.4806
3 V C -0.0253
4 P C -0.5781
5 V C -0.3854
6 T C -0.7229
7 K C -1.0371
8 L C -0.1514
9 V C 0.0000
10 C C 0.0000
11 D C -0.9057
12 G C -0.7274
13 D C -1.8124
14 T C -1.1175
15 Y C -0.5681
16 K C -1.4969
17 C C 0.0000
18 T C -0.4246
19 A C 0.0000
20 Y C -0.1775
21 L C 0.0000
22 D C -1.8164
23 Y C -0.3213
24 G C -1.3250
25 D C -2.4103
26 G C -1.8571
27 K C -1.6720
28 W C -0.4951
29 V C 0.0000
30 A C 0.0000
31 Q C -0.4853
32 W C -1.1800
33 D C -1.7968
34 T C 0.0000
35 A C -0.1697
36 V C 0.0940
37 F C 0.3729
38 H C -0.9045
39 T C -0.7279
40 T C -0.5806
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018