Project name: P.sativum333 [mutate: YT24A]

Chain sequence(s)	A: MGFTEKQEALVNSSWELFKQNPSYSVLFYTIILKKAPAAKGMFSFLKDSAEVVDSPKLQAHAEKVFGMVHDSAIQLRASGEVVLGDATLGAIHIQKGVVDPHFVVVKEALLETIKEASGEKWSEELSTAWEVAYEGLASAIKKAMN
Selected Chain(s)	A
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	No
Mutated residues	YT24A
Energy difference between WT (input) and mutated protein (by FoldX)	1.29879 kcal/mol CAUTION: Your mutation/s can destabilize the protein structure

Simulation log

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:02)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:02)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:02)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:02)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:02)
[INFO]       FoldX:    Building mutant model                                                       (00:02:54)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:03:05)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:52)
[INFO]       Main:     Simulation completed successfully.                                          (00:05:53)

• Minimal score value: -3.0979
• Maximal score value: 1.1013
• Average score: -0.9437
• Total score value: -137.7743

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
1	M	A	0.8143
2	G	A	-0.6071
3	F	A	-1.0996
4	T	A	-1.7210
5	E	A	-2.9586
6	K	A	-2.9742
7	Q	A	0.0000
8	E	A	-1.7854
9	A	A	-1.1608
10	L	A	-1.1656
11	V	A	0.0000
12	N	A	-1.1382
13	S	A	-1.0225
14	S	A	0.0000
15	W	A	0.0000
16	E	A	-2.6878
17	L	A	-1.9162
18	F	A	0.0000
19	K	A	-3.0979
20	Q	A	-2.7691
21	N	A	-2.3711
22	P	A	-1.8328
23	S	A	-1.0452
24	T	A	0.0000	mutated: YT24A
25	S	A	0.0000
26	V	A	-0.1234
27	L	A	-0.0506
28	F	A	0.0000
29	Y	A	0.0000
30	T	A	-0.4585
31	I	A	-0.8335
32	I	A	0.0000
33	L	A	-1.3320
34	K	A	-2.2755
35	K	A	-2.1625
36	A	A	-1.2006
37	P	A	-1.1108
38	A	A	-0.5877
39	A	A	0.0000
40	K	A	-1.5020
41	G	A	-1.4732
42	M	A	-0.9903
43	F	A	0.0000
44	S	A	-1.3597
45	F	A	-1.3345
46	L	A	0.0000
47	K	A	-2.9298
48	D	A	-2.8966
49	S	A	-1.6999
50	A	A	-1.3739
51	E	A	-2.0675
52	V	A	-0.8806
53	V	A	-0.4089
54	D	A	-1.8422
55	S	A	-1.3782
56	P	A	-1.5915
57	K	A	-2.3209
58	L	A	0.0000
59	Q	A	-2.1158
60	A	A	-1.6679
61	H	A	-1.6198
62	A	A	0.0000
63	E	A	-2.3049
64	K	A	-1.9700
65	V	A	-0.8036
66	F	A	0.0000
67	G	A	-1.3852
68	M	A	-0.8910
69	V	A	0.0000
70	H	A	-0.9562
71	D	A	-1.2888
72	S	A	0.0000
73	A	A	0.0000
74	I	A	-1.1034
75	Q	A	-1.0614
76	L	A	-1.3177
77	R	A	-2.5505
78	A	A	-1.2949
79	S	A	-1.1748
80	G	A	-1.7205
81	E	A	-1.8222
82	V	A	-0.5199
83	V	A	1.1013
84	L	A	0.5460
85	G	A	-0.2096
86	D	A	-0.6008
87	A	A	0.0308
88	T	A	0.0865
89	L	A	0.3315
90	G	A	0.0000
91	A	A	0.5662
92	I	A	0.9781
93	H	A	0.5731
94	I	A	0.9658
95	Q	A	-0.5747
96	K	A	-0.8855
97	G	A	-0.2708
98	V	A	0.0521
99	V	A	0.2781
100	D	A	-1.1703
101	P	A	-0.2028
102	H	A	-0.0521
103	F	A	0.0000
104	V	A	1.0366
105	V	A	0.0446
106	V	A	0.2821
107	K	A	-0.4262
108	E	A	-0.8580
109	A	A	0.0000
110	L	A	0.0000
111	L	A	-1.2864
112	E	A	-1.9777
113	T	A	0.0000
114	I	A	0.0000
115	K	A	-2.8279
116	E	A	-2.9198
117	A	A	-2.3834
118	S	A	0.0000
119	G	A	-2.5097
120	E	A	-3.0665
121	K	A	-2.8476
122	W	A	-2.3422
123	S	A	-2.2050
124	E	A	-2.7526
125	E	A	-2.8985
126	L	A	0.0000
127	S	A	-1.5366
128	T	A	-1.1744
129	A	A	0.0000
130	W	A	0.0000
131	E	A	-1.1383
132	V	A	-0.1476
133	A	A	0.0000
134	Y	A	0.0000
135	E	A	-1.5895
136	G	A	-0.9892
137	L	A	0.0000
138	A	A	0.0000
139	S	A	-1.0629
140	A	A	0.0000
141	I	A	0.0000
142	K	A	-1.7247
143	K	A	-2.3732
144	A	A	-1.0844
145	M	A	-0.6274
146	N	A	-1.6387