Project name: prot

Status: done

Started: 2026-05-22 13:41:48
Settings
Chain sequence(s) A: NPRGVAYIINNKNFARFSGMPKRNGTDVDARALNKLWTDFGFKTKTFTDVSGYDMRQNLRSLAKQDHSDYDCVIVSILTHGVEGKLYASDGELVPVEELIQLFNAGEVHKSLIGKPRLFFLQACRGDYFDKGVDQPDGGALALKMLEDYDFTDGKLQSLPSQADMFIGYATIPGYVSWRNSERGAWFVQGIVNVFTRFADSEHLADLNDRVNRYVAIEVEHPATTSKSHP
input PDB
Selected Chain(s) A
Distance of aggregation 10 Å
FoldX usage Yes
Dynamic mode No
Automated mutations No
Downloads Download all the data
Simulation log
[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:01)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:01)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with A chain(s) selected             (00:00:01)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:01)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:01)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:03:36)
[INFO]       Main:     Simulation completed successfully.                                          (00:03:38)
Show buried residues

Minimal score value
-3.64
Maximal score value
1.8987
Average score
-0.8629
Total score value
-198.4701

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index residue name chain Aggrescan3D score mutation
residue index residue name chain Aggrescan3D score
mutation
1 N A -2.2797
2 P A -2.4891
3 R A -3.1932
4 G A 0.0000
5 V A 0.0000
6 A A 0.0000
7 Y A -0.6101
8 I A 0.0000
9 I A 0.0000
10 N A 0.0000
11 N A 0.0000
12 K A -1.6654
13 N A -1.8735
14 F A 0.0000
15 A A -1.0827
16 R A -1.3691
17 F A 0.8158
18 S A -0.0654
19 G A -0.5055
20 M A -0.6393
21 P A -1.6266
22 K A -2.6151
23 R A 0.0000
24 N A -2.6494
25 G A -2.0395
26 T A 0.0000
27 D A -1.2493
28 V A -0.9324
29 D A 0.0000
30 A A 0.0000
31 R A -2.2932
32 A A -1.4212
33 L A 0.0000
34 N A -2.3800
35 K A -2.8014
36 L A 0.0000
37 W A 0.0000
38 T A -2.2700
39 D A -2.3643
40 F A -1.5405
41 G A -1.9228
42 F A 0.0000
43 K A -2.4508
44 T A -1.7710
45 K A -1.6121
46 T A -0.8047
47 F A -0.3397
48 T A -0.4934
49 D A -1.1553
50 V A 0.0000
51 S A -0.5818
52 G A 0.0000
53 Y A 0.4797
54 D A -0.7335
55 M A 0.0000
56 R A -0.8342
57 Q A -0.9998
58 N A -0.9147
59 L A 0.0000
60 R A -2.5097
61 S A -1.6366
62 L A 0.0000
63 A A 0.0000
64 K A -3.2571
65 Q A -2.6047
66 D A -3.0717
67 H A 0.0000
68 S A -2.1584
69 D A -3.0165
70 Y A -2.8889
71 D A -2.9999
72 C A 0.0000
73 V A 0.0000
74 I A 0.0000
75 V A 0.0000
76 S A 0.0000
77 I A 0.0000
78 L A 0.0000
79 T A 0.0000
80 H A -0.2038
81 G A -0.4892
82 V A -0.9770
83 E A -2.2377
84 G A -1.6254
85 K A -1.3443
86 L A 0.0000
87 Y A -0.0924
88 A A 0.0000
89 S A -1.1978
90 D A -0.9633
91 G A -0.6354
92 E A -0.6294
93 L A -0.0398
94 V A 0.0000
95 P A -1.2038
96 V A 0.0000
97 E A -2.4503
98 E A -1.8482
99 L A 0.0000
100 I A -1.3276
101 Q A -2.3861
102 L A -1.7985
103 F A 0.0000
104 N A -1.4489
105 A A -1.3533
106 G A -1.5249
107 E A -2.4170
108 V A 0.0000
109 H A -2.4922
110 K A -2.4396
111 S A -1.9688
112 L A 0.0000
113 I A -0.2788
114 G A -0.7494
115 K A -0.9368
116 P A -0.8248
117 R A 0.0000
118 L A 0.3493
119 F A 0.0000
120 F A 0.0000
121 L A 0.0000
122 Q A 0.0000
123 A A 0.0000
124 C A -0.0076
125 R A -0.5597
126 G A -0.5254
127 D A -0.8872
128 Y A 1.0536
129 F A 1.3885
130 D A -0.2523
131 K A -1.5958
132 G A -1.3293
133 V A -0.2596
134 D A -2.0736
135 Q A -2.2655
136 P A -2.1117
137 D A -2.7756
138 G A -1.5420
139 G A -0.6358
140 A A 0.3530
141 L A 1.5886
142 A A 1.3948
143 L A 1.5625
144 K A -0.2407
145 M A 0.9563
146 L A 0.8555
147 E A -1.7003
148 D A -1.8381
149 Y A 0.0486
150 D A -1.2216
151 F A 0.6651
152 T A -0.6693
153 D A -2.2860
154 G A -1.6902
155 K A -2.0977
156 L A -0.2027
157 Q A -1.2718
158 S A -0.4508
159 L A -0.2147
160 P A -0.8698
161 S A -1.2203
162 Q A -1.6829
163 A A -1.0080
164 D A -1.2474
165 M A -0.4223
166 F A 0.4793
167 I A 1.1409
168 G A 0.0000
169 Y A 0.7246
170 A A 0.0000
171 T A 0.8993
172 I A 1.8987
173 P A 0.3711
174 G A 0.1175
175 Y A 1.0578
176 V A 0.9276
177 S A 0.6287
178 W A 0.3356
179 R A -1.3952
180 N A -2.0039
181 S A -2.2522
182 E A -2.8460
183 R A -2.2772
184 G A 0.0000
185 A A 0.0000
186 W A -0.0866
187 F A 0.0000
188 V A 0.0000
189 Q A -0.1632
190 G A 0.0000
191 I A 0.0000
192 V A -0.3742
193 N A -0.6343
194 V A 0.0000
195 F A 0.0000
196 T A -1.2441
197 R A -2.0381
198 F A -1.5493
199 A A -1.5282
200 D A -2.2659
201 S A -1.5464
202 E A -1.8416
203 H A -1.7600
204 L A -0.9951
205 A A -1.4944
206 D A -2.7551
207 L A 0.0000
208 N A -2.3161
209 D A -3.6400
210 R A -3.0315
211 V A 0.0000
212 N A -2.8438
213 R A -2.6151
214 Y A -0.8737
215 V A -0.5949
216 A A -0.7444
217 I A 0.2176
218 E A -0.1711
219 V A -0.7801
220 E A -1.9488
221 H A -1.1592
222 P A -0.8265
223 A A -0.7579
224 T A -0.9514
225 T A -0.8939
226 S A -1.2560
227 K A -2.2144
228 S A -1.6710
229 H A -1.6814
230 P A -1.0045
Download PDB file
View in 3Dmol
Play the video

Laboratory of Theory of Biopolymers 2018