Aggrescan3D: Mut-5

Project name: Mut-5

Status: done

Started: 2024-06-25 16:29:22

Settings

Chain sequence(s)	M: NFNVYKATRPYLAHCPDCGEGHSCHSPIALERIRNEATDGTLKNQVSLQIGIKTDDSHDWTKLRYMDSHTPADAERAGLLVRTSAPCTNTGTMGHFILARCPKGETLTVGFTDSRKISHTCTHPFHHEPPVIGRERFHSRPQHGKELPCSTSVQSTAATAEEIEVHMPPDTPDRTLMTQQSGNVKNTVNGQTVRYKCNCGGSNEGLTTTDKVINNCKIDQCHAAVTNHKNWQYNSPLVPRNAELGDRKGKIHIPFPLANVTCRVPKARNPTVTYGKNQVKMLLYPDHPTLLSYRNMGQEPNYHEEWVTHKKEVTKTVPTEGLEVTWGNNEPYKYWPQMSTNGTAHGHPHEIIQYYYELYPTMTQVMQSVASSVLESMVGTAKGMCVCARRRCITPYELTPGATVPFELSQKCCA input PDB
Selected Chain(s)	M
Distance of aggregation	10 Å
FoldX usage	Yes
Dynamic mode	No
Automated mutations	Yes
Downloads	Download all the data

Simulation log

Toggle log display

[INFO]       Logger:   Verbosity set to: 2 - [INFO]                                                (00:00:00)
[WARNING]    runJob:   Working directory already exists (possibly overwriting previous results -ow 
                       to prevent this behavior)                                                   (00:00:00)
[INFO]       runJob:   Starting aggrescan3d job on: input.pdb with M chain(s) selected             (00:00:00)
[INFO]       runJob:   Creating pdb object from: input.pdb                                         (00:00:00)
[INFO]       FoldX:    Starting FoldX energy minimalization                                        (00:00:00)
[INFO]       Analysis: Starting Aggrescan3D on folded.pdb                                          (00:05:16)
[INFO]       Auto_mut: Residue number 377 from chain M and a score of 2.442 (valine) selected for  
                       automated muatation                                                         (00:05:19)
[INFO]       Auto_mut: Residue number 378 from chain M and a score of 2.115 (leucine) selected for 
                       automated muatation                                                         (00:05:19)
[INFO]       Auto_mut: Residue number 373 from chain M and a score of 2.098 (valine) selected for  
                       automated muatation                                                         (00:05:19)
[INFO]       Auto_mut: Residue number 366 from chain M and a score of 1.547 (methionine) selected  
                       for automated muatation                                                     (00:05:19)
[INFO]       Auto_mut: Residue number 363 from chain M and a score of 1.528 (tyrosine) selected    
                       for automated muatation                                                     (00:05:19)
[INFO]       Auto_mut: Residue number 381 from chain M and a score of 1.474 (methionine) selected  
                       for automated muatation                                                     (00:05:19)
[INFO]       Auto_mut: Residue number 359 from chain M and a score of 1.422 (tyrosine) selected    
                       for automated muatation                                                     (00:05:19)
[INFO]       Auto_mut: Residue number 374 from chain M and a score of 1.335 (alanine) selected for 
                       automated muatation                                                         (00:05:19)
[INFO]       Auto_mut: Residue number 369 from chain M and a score of 1.334 (valine) selected for  
                       automated muatation                                                         (00:05:19)
[INFO]       Auto_mut: Residue number 84 from chain M and a score of 1.238 (leucine) selected for  
                       automated muatation                                                         (00:05:19)
[INFO]       Auto_mut: Mutating residue number 377 from chain M (valine) into glutamic acid        (00:05:19)
[INFO]       Auto_mut: Mutating residue number 378 from chain M (leucine) into glutamic acid       (00:05:19)
[INFO]       Auto_mut: Mutating residue number 373 from chain M (valine) into glutamic acid        (00:05:19)
[INFO]       Auto_mut: Mutating residue number 373 from chain M (valine) into lysine               (00:07:36)
[INFO]       Auto_mut: Mutating residue number 378 from chain M (leucine) into lysine              (00:07:36)
[INFO]       Auto_mut: Mutating residue number 377 from chain M (valine) into lysine               (00:07:38)
[INFO]       Auto_mut: Mutating residue number 378 from chain M (leucine) into aspartic acid       (00:09:59)
[INFO]       Auto_mut: Mutating residue number 373 from chain M (valine) into aspartic acid        (00:09:59)
[INFO]       Auto_mut: Mutating residue number 377 from chain M (valine) into aspartic acid        (00:10:06)
[INFO]       Auto_mut: Mutating residue number 373 from chain M (valine) into arginine             (00:12:13)
[INFO]       Auto_mut: Mutating residue number 378 from chain M (leucine) into arginine            (00:12:14)
[INFO]       Auto_mut: Mutating residue number 377 from chain M (valine) into arginine             (00:12:21)
[INFO]       Auto_mut: Mutating residue number 366 from chain M (methionine) into glutamic acid    (00:14:31)
[INFO]       Auto_mut: Mutating residue number 363 from chain M (tyrosine) into glutamic acid      (00:14:39)
[INFO]       Auto_mut: Mutating residue number 381 from chain M (methionine) into glutamic acid    (00:14:41)
[INFO]       Auto_mut: Mutating residue number 366 from chain M (methionine) into lysine           (00:16:51)
[INFO]       Auto_mut: Mutating residue number 363 from chain M (tyrosine) into lysine             (00:16:56)
[INFO]       Auto_mut: Mutating residue number 381 from chain M (methionine) into lysine           (00:17:02)
[INFO]       Auto_mut: Mutating residue number 366 from chain M (methionine) into aspartic acid    (00:19:11)
[INFO]       Auto_mut: Mutating residue number 363 from chain M (tyrosine) into aspartic acid      (00:19:26)
[INFO]       Auto_mut: Mutating residue number 381 from chain M (methionine) into aspartic acid    (00:19:30)
[INFO]       Auto_mut: Mutating residue number 366 from chain M (methionine) into arginine         (00:21:27)
[INFO]       Auto_mut: Mutating residue number 363 from chain M (tyrosine) into arginine           (00:21:38)
[INFO]       Auto_mut: Mutating residue number 381 from chain M (methionine) into arginine         (00:21:50)
[INFO]       Auto_mut: Mutating residue number 359 from chain M (tyrosine) into glutamic acid      (00:23:46)
[INFO]       Auto_mut: Mutating residue number 374 from chain M (alanine) into glutamic acid       (00:23:58)
[INFO]       Auto_mut: Mutating residue number 369 from chain M (valine) into glutamic acid        (00:24:09)
[INFO]       Auto_mut: Mutating residue number 359 from chain M (tyrosine) into lysine             (00:26:02)
[INFO]       Auto_mut: Mutating residue number 374 from chain M (alanine) into lysine              (00:26:14)
[INFO]       Auto_mut: Mutating residue number 369 from chain M (valine) into lysine               (00:26:28)
[INFO]       Auto_mut: Mutating residue number 374 from chain M (alanine) into aspartic acid       (00:28:49)
[INFO]       Auto_mut: Mutating residue number 359 from chain M (tyrosine) into aspartic acid      (00:28:53)
[INFO]       Auto_mut: Mutating residue number 369 from chain M (valine) into aspartic acid        (00:29:09)
[INFO]       Auto_mut: Mutating residue number 374 from chain M (alanine) into arginine            (00:31:14)
[INFO]       Auto_mut: Mutating residue number 359 from chain M (tyrosine) into arginine           (00:31:18)
[INFO]       Auto_mut: Mutating residue number 369 from chain M (valine) into arginine             (00:31:34)
[INFO]       Auto_mut: Mutating residue number 84 from chain M (leucine) into glutamic acid        (00:33:45)
[INFO]       Auto_mut: Mutating residue number 84 from chain M (leucine) into lysine               (00:36:08)
[INFO]       Auto_mut: Mutating residue number 84 from chain M (leucine) into aspartic acid        (00:38:39)
[INFO]       Auto_mut: Mutating residue number 84 from chain M (leucine) into arginine             (00:40:56)
[INFO]       Auto_mut: Effect of mutation residue number 377 from chain M (valine) into glutamic   
                       acid: Energy difference: -0.1749 kcal/mol, Difference in average score from 
                       the base case: -0.0448                                                      (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 377 from chain M (valine) into lysine:    
                       Energy difference: -0.4495 kcal/mol, Difference in average score from the   
                       base case: -0.0450                                                          (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 377 from chain M (valine) into aspartic   
                       acid: Energy difference: 0.2543 kcal/mol, Difference in average score from  
                       the base case: -0.0432                                                      (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 377 from chain M (valine) into arginine:  
                       Energy difference: -0.2369 kcal/mol, Difference in average score from the   
                       base case: -0.0474                                                          (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 378 from chain M (leucine) into glutamic  
                       acid: Energy difference: 0.6372 kcal/mol, Difference in average score from  
                       the base case: -0.0454                                                      (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 378 from chain M (leucine) into lysine:   
                       Energy difference: 0.2494 kcal/mol, Difference in average score from the    
                       base case: -0.0392                                                          (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 378 from chain M (leucine) into aspartic  
                       acid: Energy difference: 1.0884 kcal/mol, Difference in average score from  
                       the base case: -0.0404                                                      (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 378 from chain M (leucine) into arginine: 
                       Energy difference: 0.0362 kcal/mol, Difference in average score from the    
                       base case: -0.0423                                                          (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 373 from chain M (valine) into glutamic   
                       acid: Energy difference: -0.0684 kcal/mol, Difference in average score from 
                       the base case: -0.0482                                                      (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 373 from chain M (valine) into lysine:    
                       Energy difference: -0.2242 kcal/mol, Difference in average score from the   
                       base case: -0.0434                                                          (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 373 from chain M (valine) into aspartic   
                       acid: Energy difference: 0.2625 kcal/mol, Difference in average score from  
                       the base case: -0.0471                                                      (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 373 from chain M (valine) into arginine:  
                       Energy difference: -0.6798 kcal/mol, Difference in average score from the   
                       base case: -0.0522                                                          (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 366 from chain M (methionine) into        
                       glutamic acid: Energy difference: 0.3689 kcal/mol, Difference in average    
                       score from the base case: -0.0317                                           (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 366 from chain M (methionine) into        
                       lysine: Energy difference: 0.5317 kcal/mol, Difference in average score     
                       from the base case: -0.0341                                                 (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 366 from chain M (methionine) into        
                       aspartic acid: Energy difference: 0.4137 kcal/mol, Difference in average    
                       score from the base case: -0.0300                                           (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 366 from chain M (methionine) into        
                       arginine: Energy difference: 0.8693 kcal/mol, Difference in average score   
                       from the base case: -0.0361                                                 (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 363 from chain M (tyrosine) into glutamic 
                       acid: Energy difference: 0.2486 kcal/mol, Difference in average score from  
                       the base case: -0.0173                                                      (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 363 from chain M (tyrosine) into lysine:  
                       Energy difference: -0.1809 kcal/mol, Difference in average score from the   
                       base case: -0.0194                                                          (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 363 from chain M (tyrosine) into aspartic 
                       acid: Energy difference: -0.1809 kcal/mol, Difference in average score from 
                       the base case: -0.0119                                                      (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 363 from chain M (tyrosine) into          
                       arginine: Energy difference: -0.0756 kcal/mol, Difference in average score  
                       from the base case: -0.0327                                                 (00:43:22)
[INFO]       Auto_mut: Effect of mutation residue number 381 from chain M (methionine) into        
                       glutamic acid: Energy difference: 0.5381 kcal/mol, Difference in average    
                       score from the base case: -0.0389                                           (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 381 from chain M (methionine) into        
                       lysine: Energy difference: 0.2404 kcal/mol, Difference in average score     
                       from the base case: -0.0400                                                 (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 381 from chain M (methionine) into        
                       aspartic acid: Energy difference: 0.9247 kcal/mol, Difference in average    
                       score from the base case: -0.0351                                           (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 381 from chain M (methionine) into        
                       arginine: Energy difference: 0.4704 kcal/mol, Difference in average score   
                       from the base case: -0.0427                                                 (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 359 from chain M (tyrosine) into glutamic 
                       acid: Energy difference: 0.5617 kcal/mol, Difference in average score from  
                       the base case: -0.0311                                                      (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 359 from chain M (tyrosine) into lysine:  
                       Energy difference: -0.0402 kcal/mol, Difference in average score from the   
                       base case: -0.0251                                                          (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 359 from chain M (tyrosine) into aspartic 
                       acid: Energy difference: 1.4799 kcal/mol, Difference in average score from  
                       the base case: -0.0191                                                      (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 359 from chain M (tyrosine) into          
                       arginine: Energy difference: 0.3285 kcal/mol, Difference in average score   
                       from the base case: -0.0359                                                 (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 374 from chain M (alanine) into glutamic  
                       acid: Energy difference: -0.1075 kcal/mol, Difference in average score from 
                       the base case: -0.0317                                                      (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 374 from chain M (alanine) into lysine:   
                       Energy difference: -0.5251 kcal/mol, Difference in average score from the   
                       base case: -0.0354                                                          (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 374 from chain M (alanine) into aspartic  
                       acid: Energy difference: 0.3120 kcal/mol, Difference in average score from  
                       the base case: -0.0318                                                      (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 374 from chain M (alanine) into arginine: 
                       Energy difference: -0.5450 kcal/mol, Difference in average score from the   
                       base case: -0.0369                                                          (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 369 from chain M (valine) into glutamic   
                       acid: Energy difference: -0.4053 kcal/mol, Difference in average score from 
                       the base case: -0.0458                                                      (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 369 from chain M (valine) into lysine:    
                       Energy difference: -0.6057 kcal/mol, Difference in average score from the   
                       base case: -0.0465                                                          (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 369 from chain M (valine) into aspartic   
                       acid: Energy difference: -0.1190 kcal/mol, Difference in average score from 
                       the base case: -0.0443                                                      (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 369 from chain M (valine) into arginine:  
                       Energy difference: -0.4238 kcal/mol, Difference in average score from the   
                       base case: -0.0499                                                          (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 84 from chain M (leucine) into glutamic   
                       acid: Energy difference: -0.2107 kcal/mol, Difference in average score from 
                       the base case: -0.0490                                                      (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 84 from chain M (leucine) into lysine:    
                       Energy difference: -0.0047 kcal/mol, Difference in average score from the   
                       base case: -0.0420                                                          (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 84 from chain M (leucine) into aspartic   
                       acid: Energy difference: 0.1554 kcal/mol, Difference in average score from  
                       the base case: -0.0475                                                      (00:43:23)
[INFO]       Auto_mut: Effect of mutation residue number 84 from chain M (leucine) into arginine:  
                       Energy difference: 0.0970 kcal/mol, Difference in average score from the    
                       base case: -0.0545                                                          (00:43:23)
[INFO]       Main:     Simulation completed successfully.                                          (00:43:34)

Note Your prediction results will be deleted after 360 days.

Drag cursor over the plot to display residue labels.

Show buried residues

Minimal score value: -3.7224
Maximal score value: 2.4421
Average score: -1.0031
Total score value: -415.2727

Download the table (csv)

The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.

residue index	residue name	chain	Aggrescan3D score	mutation
residue index	residue name	chain	Aggrescan3D score	mutation
5	N	M	-1.4528
6	F	M	-1.3367
7	N	M	-1.8110
8	V	M	-0.5241
9	Y	M	0.0000
10	K	M	-2.2849
11	A	M	-1.3096
12	T	M	-0.8081
13	R	M	-0.7963
14	P	M	0.0000
15	Y	M	0.0000
16	L	M	0.2016
17	A	M	0.0000
18	H	M	-1.1141
19	C	M	0.0000
20	P	M	-1.3055
21	D	M	-1.9809
22	C	M	-1.6110
23	G	M	-1.8621
24	E	M	-2.6804
25	G	M	-2.1846
26	H	M	-2.0912
27	S	M	-1.6301
28	C	M	-1.0219
29	H	M	-1.1819
30	S	M	0.0000
31	P	M	-0.3875
32	I	M	0.0000
33	A	M	0.0000
34	L	M	0.0000
35	E	M	-1.4823
36	R	M	-2.4677
37	I	M	-2.0454
38	R	M	-3.3511
39	N	M	-3.4640
40	E	M	-3.0600
41	A	M	-2.0113
42	T	M	-1.3680
43	D	M	-2.1568
44	G	M	-2.2899
45	T	M	-2.0206
46	L	M	0.0000
47	K	M	-1.7331
48	N	M	0.0000
49	Q	M	-0.9734
50	V	M	0.0000
51	S	M	0.0000
52	L	M	0.0000
53	Q	M	0.0000
54	I	M	0.0000
55	G	M	0.0000
56	I	M	0.0000
57	K	M	-1.9569
58	T	M	-2.0674
59	D	M	-2.7395
60	D	M	-2.8729
61	S	M	-2.0599
62	H	M	-1.9177
63	D	M	-1.0914
64	W	M	-0.2025
65	T	M	-0.8529
66	K	M	-1.7629
67	L	M	0.0000
68	R	M	0.0000
69	Y	M	0.0000
70	M	M	-0.8131
71	D	M	-1.6677
72	S	M	-1.1106
73	H	M	-1.1672
74	T	M	-0.9423
75	P	M	-1.0182
76	A	M	-1.0230
77	D	M	-2.0137
78	A	M	-2.1284
79	E	M	-2.4881
80	R	M	-1.3853
81	A	M	-0.6127
82	G	M	-0.3251
83	L	M	0.5142
84	L	M	1.2378
85	V	M	0.0505
86	R	M	-1.1069
87	T	M	0.0000
88	S	M	-1.2535
89	A	M	-0.7158
90	P	M	-0.7479
91	C	M	-0.8714
92	T	M	-0.9513
93	N	M	-0.9630
94	T	M	-0.9610
95	G	M	-0.5554
96	T	M	-0.2374
97	M	M	0.0000
98	G	M	0.0000
99	H	M	-0.1634
100	F	M	0.0000
101	I	M	0.0000
102	L	M	0.0000
103	A	M	0.0000
104	R	M	-2.3679
105	C	M	-1.6308
106	P	M	-1.7923
107	K	M	-2.8949
108	G	M	-2.6047
109	E	M	-2.8714
110	T	M	-1.6763
111	L	M	0.0000
112	T	M	-0.3425
113	V	M	0.0000
114	G	M	0.2070
115	F	M	0.0000
116	T	M	-0.7459
117	D	M	-1.6225
118	S	M	-1.8953
119	R	M	-2.3355
120	K	M	-1.8971
121	I	M	0.2028
122	S	M	-0.1713
123	H	M	-0.0532
124	T	M	-0.2242
125	C	M	0.0000
126	T	M	-0.6472
127	H	M	-0.8319
128	P	M	-0.9583
129	F	M	-0.9907
130	H	M	-2.3310
131	H	M	-2.6481
132	E	M	-2.7349
133	P	M	-1.6295
134	P	M	-0.3615
135	V	M	0.8286
136	I	M	0.2127
137	G	M	-0.8138
138	R	M	-1.1625
139	E	M	0.0000
140	R	M	-1.7962
141	F	M	-1.2243
142	H	M	-1.5824
143	S	M	-1.7543
144	R	M	-2.8640
145	P	M	-2.5986
146	Q	M	-2.5383
147	H	M	-2.6848
148	G	M	-3.1221
149	K	M	-3.0972
150	E	M	-3.0275
151	L	M	-1.2902
152	P	M	-0.8001
153	C	M	-0.8433
154	S	M	-0.7291
155	T	M	-0.6417
156	S	M	-0.2289
157	V	M	0.1741
158	Q	M	-0.8409
159	S	M	-0.5204
160	T	M	-0.4872
161	A	M	-0.3896
162	A	M	-0.5680
163	T	M	-0.7630
164	A	M	-1.1782
165	E	M	-2.3962
166	E	M	-2.5453
167	I	M	-1.6788
168	E	M	-2.4584
169	V	M	0.0000
170	H	M	-2.5881
171	M	M	-1.7963
172	P	M	0.0000
173	P	M	-2.0176
174	D	M	-2.8057
175	T	M	-1.4894
176	P	M	-1.6420
177	D	M	-1.6463
178	R	M	-2.2105
179	T	M	-0.9943
180	L	M	-0.8629
181	M	M	-0.9602
182	T	M	-1.4571
183	Q	M	-2.4356
184	Q	M	-2.3600
185	S	M	-1.8809
186	G	M	-2.1937
187	N	M	-2.0960
188	V	M	0.0000
189	K	M	-0.9560
190	N	M	0.0000
191	T	M	-1.0189
192	V	M	0.0000
193	N	M	-1.8138
194	G	M	-1.2384
195	Q	M	-1.1545
196	T	M	-0.8414
197	V	M	0.0000
198	R	M	-2.3652
199	Y	M	0.0000
200	K	M	-2.9754
201	C	M	0.0000
202	N	M	-2.8224
203	C	M	-2.2870
204	G	M	-1.5485
205	G	M	-1.3325
206	S	M	-2.1048
207	N	M	-2.7244
208	E	M	-3.0015
209	G	M	-1.2527
210	L	M	0.2516
211	T	M	-0.4390
212	T	M	-0.8171
213	T	M	-1.3300
214	D	M	-2.1628
215	K	M	-0.9959
216	V	M	0.5404
217	I	M	-0.5590
218	N	M	-1.8994
219	N	M	-2.4883
220	C	M	-2.5901
221	K	M	-3.1804
222	I	M	-2.0579
223	D	M	-2.9513
224	Q	M	-2.8734
225	C	M	-2.4506
226	H	M	-2.5307
227	A	M	0.0000
228	A	M	0.0000
229	V	M	-1.4205
230	T	M	-1.5805
231	N	M	-2.3462
232	H	M	-1.9936
233	K	M	-2.1631
234	N	M	-1.5414
235	W	M	-1.1630
236	Q	M	-0.5283
237	Y	M	-0.4778
238	N	M	-1.2991
239	S	M	0.0000
240	P	M	-0.2491
241	L	M	0.3269
242	V	M	-0.2761
243	P	M	-1.5212
244	R	M	-3.0120
245	N	M	-3.0416
246	A	M	-1.9328
247	E	M	-1.9787
248	L	M	-0.6428
249	G	M	-2.3321
250	D	M	-3.2744
251	R	M	-3.7224
252	K	M	-3.2096
253	G	M	-2.0734
254	K	M	-2.0780
255	I	M	0.0000
256	H	M	-1.3927
257	I	M	-0.7852
258	P	M	0.0000
259	F	M	0.0000
260	P	M	0.1892
261	L	M	0.6616
262	A	M	0.2030
263	N	M	-0.6908
264	V	M	-0.0440
265	T	M	-0.8984
266	C	M	-1.8574
267	R	M	-3.4988
268	V	M	0.0000
269	P	M	-2.7583
270	K	M	-2.5162
271	A	M	-2.1580
272	R	M	-2.8753
273	N	M	-2.0679
274	P	M	-0.6499
275	T	M	-0.0800
276	V	M	1.1260
277	T	M	0.7715
278	Y	M	0.5191
279	G	M	-1.1583
280	K	M	-2.3337
281	N	M	-2.0696
282	Q	M	-1.6657
283	V	M	0.0000
284	K	M	-0.7778
285	M	M	0.0000
286	L	M	-0.7412
287	L	M	0.0000
288	Y	M	-1.3681
289	P	M	-1.8160
290	D	M	-2.5238
291	H	M	-1.6918
292	P	M	-1.0103
293	T	M	0.0000
294	L	M	-0.6229
295	L	M	0.0000
296	S	M	-0.9365
297	Y	M	-0.7315
298	R	M	-1.1642
299	N	M	-1.6430
300	M	M	-1.7645
301	G	M	-2.0279
302	Q	M	-2.6381
303	E	M	-2.8271
304	P	M	-1.8354
305	N	M	-1.6591
306	Y	M	-0.5708
307	H	M	-1.8496
308	E	M	-2.3779
309	E	M	-1.7372
310	W	M	-0.0553
311	V	M	0.0000
312	T	M	-1.0741
313	H	M	-2.1939
314	K	M	-2.9042
315	K	M	-2.5273
316	E	M	-2.4361
317	V	M	-1.0645
318	T	M	-0.8514
319	K	M	-0.6673
320	T	M	-1.0622
321	V	M	0.0000
322	P	M	-0.7231
323	T	M	-0.9527
324	E	M	-1.6034
325	G	M	0.0000
326	L	M	0.0000
327	E	M	-0.9556
328	V	M	0.0000
329	T	M	-0.7534
330	W	M	0.0000
331	G	M	0.0000
332	N	M	0.0000
333	N	M	-1.9939
334	E	M	-1.9487
335	P	M	-1.4226
336	Y	M	-1.1226
337	K	M	-1.4218
338	Y	M	-0.4160
339	W	M	0.0578
340	P	M	-0.6735
341	Q	M	-0.8676
342	M	M	0.0261
343	S	M	-0.7098
344	T	M	-0.9885
345	N	M	-1.8433
346	G	M	-1.2435
347	T	M	-0.9224
348	A	M	-0.5066
349	H	M	-1.4610
350	G	M	-1.7079
351	H	M	-1.8070
352	P	M	-1.3787
353	H	M	-1.4820
354	E	M	-1.5387
355	I	M	-0.1817
356	I	M	0.3349
357	Q	M	-0.7424
358	Y	M	-0.0458
359	Y	M	1.4221
360	Y	M	0.8416
361	E	M	-0.7306
362	L	M	0.8038
363	Y	M	1.5275
364	P	M	0.5621
365	T	M	0.7059
366	M	M	1.5473
367	T	M	0.0000
368	Q	M	0.0921
369	V	M	1.3336
370	M	M	1.0834
371	Q	M	-0.1869
372	S	M	0.4772
373	V	M	2.0978
374	A	M	1.3350
375	S	M	0.5562
376	S	M	0.8372
377	V	M	2.4421
378	L	M	2.1145
379	E	M	-0.1138
380	S	M	0.6589
381	M	M	1.4744
382	V	M	1.1325
383	G	M	-0.2521
384	T	M	-0.1094
385	A	M	0.1394
386	K	M	-0.7745
387	G	M	0.1163
388	M	M	0.9556
389	C	M	0.4987
390	V	M	0.5200
391	C	M	0.0857
392	A	M	-0.4869
393	R	M	-1.2967
394	R	M	-2.5756
395	R	M	-2.6115
396	C	M	-1.1863
397	I	M	-0.8202
398	T	M	-1.2764
399	P	M	-0.4733
400	Y	M	0.1416
401	E	M	-0.8533
402	L	M	0.6380
403	T	M	0.0387
404	P	M	-0.3360
405	G	M	-0.5534
406	A	M	-0.1619
407	T	M	0.1328
408	V	M	0.5182
409	P	M	0.5640
410	F	M	0.8063
411	E	M	-1.1386
412	L	M	-0.3631
413	S	M	-0.3772
414	Q	M	-1.6772
415	K	M	-2.0101
416	C	M	-0.5297
417	C	M	-0.8192
418	A	M	-0.8448

3Dmol can be expensive computationally for big molecules. If you experience lag or delay click on the "Play the video" button instead.

Download PDB file

View in 3Dmol

Start animation

Play the video

Automated mutations analysis

In the automated mutations mode, the server selects aggregation prone resides and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine. The table below shows 2 best scored mutants for each mutated residue. Protein variants are ordered according to the mutation effect they had on protein stability (energetic effect) together with the difference in the average per-residue aggregation score between the wild type and the mutant (in the table green values indicate a positive change, grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this CSV file.

Mutant	Energetic effect	Score comparison
VR373M	-0.6798	-0.0522	View	CSV	PDB
VK369M	-0.6057	-0.0465	View	CSV	PDB
VR369M	-0.4238	-0.0499	View	CSV	PDB
VK377M	-0.4495	-0.045	View	CSV	PDB
AR374M	-0.545	-0.0369	View	CSV	PDB
AK374M	-0.5251	-0.0354	View	CSV	PDB
VR377M	-0.2369	-0.0474	View	CSV	PDB
LE84M	-0.2107	-0.049	View	CSV	PDB
VK373M	-0.2242	-0.0434	View	CSV	PDB
LK84M	-0.0047	-0.042	View	CSV	PDB
YR363M	-0.0756	-0.0327	View	CSV	PDB
YK359M	-0.0402	-0.0251	View	CSV	PDB
YK363M	-0.1809	-0.0194	View	CSV	PDB
LR378M	0.0362	-0.0423	View	CSV	PDB
MK381M	0.2404	-0.04	View	CSV	PDB
LK378M	0.2494	-0.0392	View	CSV	PDB
YR359M	0.3285	-0.0359	View	CSV	PDB
MR381M	0.4704	-0.0427	View	CSV	PDB
ME366M	0.3689	-0.0317	View	CSV	PDB
MD366M	0.4137	-0.03	View	CSV	PDB

Project name: Mut-5

Status: done

Started: 2024-06-25 16:29:22

Automated mutations analysis

Mutant

Energetic effect

Score comparison