| Chain sequence(s) |
A: VGSLNCIVAVSQNMMGIGKNGDLPWPPPLRNEFRYFQRRMTTTSSVEGKQNLVIMGKKTWFSIPEKNRPLKGRINLVLSRELKEPPQGAHFLSRSLDDDALKLTEQPELANKVDMVWIVGGSSVYKEAMNNHPGHLKLFVTRIMQDFESDTFFPEIDLEKYKLLPEYPGVLSDVQEEEKGIKYKFEVYEKND
input PDB |
| Selected Chain(s) | A |
| Distance of aggregation | 10 Å |
| FoldX usage | Yes |
| Dynamic mode | No |
| Automated mutations | Yes |
| Downloads | Download all the data |
| Simulation log |
[INFO] Logger: Verbosity set to: 2 - [INFO] (00:00:01)
[WARNING] runJob: Working directory already exists (possibly overwriting previous results -ow
to prevent this behavior) (00:00:01)
[INFO] runJob: Starting aggrescan3d job on: input.pdb with A chain(s) selected (00:00:01)
[INFO] runJob: Creating pdb object from: input.pdb (00:00:01)
[INFO] FoldX: Starting FoldX energy minimalization (00:00:01)
[INFO] Analysis: Starting Aggrescan3D on folded.pdb (00:02:34)
[INFO] Auto_mut: Residue number 1 from chain A and a score of 0.701 (valine) selected for
automated muatation (00:02:35)
[INFO] Auto_mut: Residue number 166 from chain A and a score of 0.567 (leucine) selected for
automated muatation (00:02:35)
[INFO] Auto_mut: Residue number 147 from chain A and a score of 0.550 (phenylalanine)
selected for automated muatation (00:02:35)
[INFO] Auto_mut: Residue number 2 from chain A and a score of 0.531 (glycine) selected for
automated muatation (00:02:35)
[INFO] Auto_mut: Residue number 115 from chain A and a score of 0.207 (valine) selected for
automated muatation (00:02:35)
[INFO] Auto_mut: Residue number 111 from chain A and a score of 0.110 (methionine) selected
for automated muatation (00:02:35)
[INFO] Auto_mut: Mutating residue number 1 from chain A (valine) into glutamic acid (00:02:35)
[INFO] Auto_mut: Mutating residue number 1 from chain A (valine) into aspartic acid (00:02:35)
[INFO] Auto_mut: Mutating residue number 166 from chain A (leucine) into glutamic acid (00:02:35)
[INFO] Auto_mut: Mutating residue number 1 from chain A (valine) into arginine (00:03:41)
[INFO] Auto_mut: Mutating residue number 1 from chain A (valine) into lysine (00:03:42)
[INFO] Auto_mut: Mutating residue number 166 from chain A (leucine) into lysine (00:03:43)
[INFO] Auto_mut: Mutating residue number 166 from chain A (leucine) into aspartic acid (00:04:49)
[INFO] Auto_mut: Mutating residue number 147 from chain A (phenylalanine) into glutamic acid
Mutating residue number 147 from chain A (phenylalanine) into glutamic acid (00:04:51)
[INFO] Auto_mut: Mutating residue number 147 from chain A (phenylalanine) into aspartic acid
Mutating residue number 147 from chain A (phenylalanine) into aspartic acid (00:04:54)
[INFO] Auto_mut: Mutating residue number 166 from chain A (leucine) into arginine (00:05:55)
[INFO] Auto_mut: Mutating residue number 147 from chain A (phenylalanine) into arginine (00:06:00)
[INFO] Auto_mut: Mutating residue number 147 from chain A (phenylalanine) into lysine (00:06:02)
[INFO] Auto_mut: Mutating residue number 2 from chain A (glycine) into glutamic acid (00:07:06)
[INFO] Auto_mut: Mutating residue number 2 from chain A (glycine) into aspartic acid (00:07:13)
[INFO] Auto_mut: Mutating residue number 115 from chain A (valine) into glutamic acid (00:07:18)
[INFO] Auto_mut: Mutating residue number 2 from chain A (glycine) into lysine (00:08:12)
[INFO] Auto_mut: Mutating residue number 2 from chain A (glycine) into arginine (00:08:17)
[INFO] Auto_mut: Mutating residue number 115 from chain A (valine) into lysine (00:08:27)
[INFO] Auto_mut: Mutating residue number 115 from chain A (valine) into aspartic acid (00:09:20)
[INFO] Auto_mut: Mutating residue number 111 from chain A (methionine) into glutamic acid (00:09:24)
[INFO] Auto_mut: Mutating residue number 111 from chain A (methionine) into aspartic acid (00:09:33)
[INFO] Auto_mut: Mutating residue number 115 from chain A (valine) into arginine (00:10:25)
[INFO] Auto_mut: Mutating residue number 111 from chain A (methionine) into lysine (00:10:34)
[INFO] Auto_mut: Mutating residue number 111 from chain A (methionine) into arginine (00:10:38)
[INFO] Auto_mut: Effect of mutation residue number 1 from chain A (valine) into glutamic
acid: Energy difference: 0.9191 kcal/mol, Difference in average score from
the base case: -0.0791 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 1 from chain A (valine) into lysine:
Energy difference: -0.4218 kcal/mol, Difference in average score from the
base case: -0.0756 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 1 from chain A (valine) into aspartic
acid: Energy difference: 0.9463 kcal/mol, Difference in average score from
the base case: -0.0844 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 1 from chain A (valine) into arginine:
Energy difference: -1.3973 kcal/mol, Difference in average score from the
base case: -0.0641 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 166 from chain A (leucine) into glutamic
acid: Energy difference: 0.3389 kcal/mol, Difference in average score from
the base case: -0.0620 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 166 from chain A (leucine) into lysine:
Energy difference: 0.1385 kcal/mol, Difference in average score from the
base case: -0.0697 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 166 from chain A (leucine) into aspartic
acid: Energy difference: 0.0022 kcal/mol, Difference in average score from
the base case: -0.0703 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 166 from chain A (leucine) into arginine:
Energy difference: 0.1077 kcal/mol, Difference in average score from the
base case: -0.0727 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 147 from chain A (phenylalanine) into
glutamic acid: Energy difference: 0.4961 kcal/mol, Difference in average
score from the base case: -0.0818 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 147 from chain A (phenylalanine) into
lysine: Energy difference: 0.0180 kcal/mol, Difference in average score
from the base case: -0.0729 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 147 from chain A (phenylalanine) into
aspartic acid: Energy difference: 1.8807 kcal/mol, Difference in average
score from the base case: -0.0919 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 147 from chain A (phenylalanine) into
arginine: Energy difference: 0.2669 kcal/mol, Difference in average score
from the base case: -0.0859 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 2 from chain A (glycine) into glutamic
acid: Energy difference: 2.0003 kcal/mol, Difference in average score from
the base case: -0.0451 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 2 from chain A (glycine) into lysine:
Energy difference: 0.8789 kcal/mol, Difference in average score from the
base case: -0.0427 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 2 from chain A (glycine) into aspartic
acid: Energy difference: 1.9792 kcal/mol, Difference in average score from
the base case: -0.0414 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 2 from chain A (glycine) into arginine:
Energy difference: 1.3377 kcal/mol, Difference in average score from the
base case: -0.0545 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 115 from chain A (valine) into glutamic
acid: Energy difference: 2.3920 kcal/mol, Difference in average score from
the base case: -0.0213 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 115 from chain A (valine) into lysine:
Energy difference: 2.4012 kcal/mol, Difference in average score from the
base case: -0.0253 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 115 from chain A (valine) into aspartic
acid: Energy difference: 3.1826 kcal/mol, Difference in average score from
the base case: -0.0273 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 115 from chain A (valine) into arginine:
Energy difference: 1.4607 kcal/mol, Difference in average score from the
base case: -0.0199 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 111 from chain A (methionine) into
glutamic acid: Energy difference: 1.4352 kcal/mol, Difference in average
score from the base case: -0.0282 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 111 from chain A (methionine) into
lysine: Energy difference: 0.0130 kcal/mol, Difference in average score
from the base case: -0.0277 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 111 from chain A (methionine) into
aspartic acid: Energy difference: 2.3086 kcal/mol, Difference in average
score from the base case: -0.0274 (00:12:03)
[INFO] Auto_mut: Effect of mutation residue number 111 from chain A (methionine) into
arginine: Energy difference: 0.4586 kcal/mol, Difference in average score
from the base case: -0.0383 (00:12:03)
[INFO] Main: Simulation completed successfully. (00:12:08)
|
The table below lists A3D score for protein residues. Residues with A3D score > 0.0000 are marked by yellow rows.
| residue index | residue name | chain | Aggrescan3D score | mutation |
|---|---|---|---|---|
| residue index | residue name | chain | Aggrescan3D score | |
| 1 | V | A | 0.7009 | |
| 2 | G | A | 0.5314 | |
| 3 | S | A | 0.0547 | |
| 4 | L | A | 0.1028 | |
| 5 | N | A | 0.0000 | |
| 6 | C | A | 0.0000 | |
| 7 | I | A | 0.0000 | |
| 8 | V | A | 0.0000 | |
| 9 | A | A | -0.0141 | |
| 10 | V | A | 0.0000 | |
| 11 | S | A | 0.0000 | |
| 12 | Q | A | -2.2072 | |
| 13 | N | A | -1.5674 | |
| 14 | M | A | -0.8774 | |
| 15 | G | A | 0.0000 | |
| 16 | I | A | -0.3148 | |
| 17 | G | A | -1.4365 | |
| 18 | K | A | -2.6053 | |
| 19 | N | A | -2.8010 | |
| 20 | G | A | -2.2371 | |
| 21 | D | A | -2.5110 | |
| 22 | L | A | -1.0273 | |
| 23 | P | A | 0.0000 | |
| 24 | W | A | 0.0000 | |
| 25 | P | A | -0.8598 | |
| 26 | P | A | -0.9432 | |
| 27 | L | A | 0.0000 | |
| 28 | R | A | -2.5298 | |
| 29 | N | A | -1.9895 | |
| 30 | E | A | 0.0000 | |
| 31 | F | A | -1.3034 | |
| 32 | R | A | -2.7005 | |
| 33 | Y | A | 0.0000 | |
| 34 | F | A | -1.0083 | |
| 35 | Q | A | -2.1317 | |
| 36 | R | A | -2.4276 | |
| 37 | M | A | -1.1063 | |
| 38 | T | A | 0.0000 | |
| 39 | T | A | -1.3788 | |
| 40 | T | A | -0.9543 | |
| 41 | S | A | -1.0294 | |
| 42 | S | A | -0.5638 | |
| 43 | V | A | -0.8395 | |
| 44 | E | A | -2.1917 | |
| 45 | G | A | -2.1311 | |
| 46 | K | A | -2.2251 | |
| 47 | Q | A | -2.0248 | |
| 48 | N | A | 0.0000 | |
| 49 | L | A | 0.0000 | |
| 50 | V | A | 0.0000 | |
| 51 | I | A | 0.0000 | |
| 52 | M | A | 0.0000 | |
| 53 | G | A | -0.7790 | |
| 54 | K | A | -1.7696 | |
| 55 | K | A | -1.8568 | |
| 56 | T | A | -0.9430 | |
| 57 | W | A | 0.0000 | |
| 58 | F | A | -0.1302 | |
| 59 | S | A | -0.9562 | |
| 60 | I | A | -1.0855 | |
| 61 | P | A | -1.7399 | |
| 62 | E | A | -3.1644 | |
| 63 | K | A | -3.3756 | |
| 64 | N | A | -3.2608 | |
| 65 | R | A | -2.5386 | |
| 66 | P | A | -2.0945 | |
| 67 | L | A | 0.0000 | |
| 68 | K | A | -2.3677 | |
| 69 | G | A | -1.6124 | |
| 70 | R | A | -1.2464 | |
| 71 | I | A | -0.7532 | |
| 72 | N | A | 0.0000 | |
| 73 | L | A | 0.0000 | |
| 74 | V | A | 0.0000 | |
| 75 | L | A | -1.4267 | |
| 76 | S | A | 0.0000 | |
| 77 | R | A | -3.5791 | |
| 78 | E | A | -3.5797 | |
| 79 | L | A | -2.8729 | |
| 80 | K | A | -3.3913 | |
| 81 | E | A | -3.0282 | |
| 82 | P | A | -1.7779 | |
| 83 | P | A | 0.0000 | |
| 84 | Q | A | -2.0193 | |
| 85 | G | A | -1.7558 | |
| 86 | A | A | 0.0000 | |
| 87 | H | A | -1.2909 | |
| 88 | F | A | -0.2672 | |
| 89 | L | A | -1.2511 | |
| 90 | S | A | 0.0000 | |
| 91 | R | A | -3.0981 | |
| 92 | S | A | -2.1615 | |
| 93 | L | A | 0.0000 | |
| 94 | D | A | -2.4244 | |
| 95 | D | A | -2.8132 | |
| 96 | A | A | 0.0000 | |
| 97 | L | A | -1.5354 | |
| 98 | K | A | -2.9396 | |
| 99 | L | A | -2.0403 | |
| 100 | T | A | 0.0000 | |
| 101 | E | A | -2.6447 | |
| 102 | Q | A | -2.4746 | |
| 103 | P | A | -2.1287 | |
| 104 | E | A | -2.4795 | |
| 105 | L | A | 0.0000 | |
| 106 | A | A | -2.1115 | |
| 107 | N | A | -2.5821 | |
| 108 | K | A | -2.6703 | |
| 109 | V | A | 0.0000 | |
| 110 | D | A | 0.0000 | |
| 111 | M | A | 0.1097 | |
| 112 | V | A | 0.0000 | |
| 113 | W | A | 0.0000 | |
| 114 | I | A | 0.0000 | |
| 115 | V | A | 0.2067 | |
| 116 | G | A | 0.0000 | |
| 117 | G | A | -0.5368 | |
| 118 | S | A | -0.3171 | |
| 119 | S | A | -0.9370 | |
| 120 | V | A | 0.0000 | |
| 121 | Y | A | 0.0000 | |
| 122 | K | A | -2.6266 | |
| 123 | E | A | -2.2955 | |
| 124 | A | A | 0.0000 | |
| 125 | M | A | 0.0000 | |
| 126 | N | A | -2.5128 | |
| 127 | H | A | -1.8349 | |
| 128 | P | A | -1.6422 | |
| 129 | G | A | -1.8180 | |
| 130 | H | A | -1.9420 | |
| 131 | L | A | 0.0000 | |
| 132 | K | A | -0.6937 | |
| 133 | L | A | 0.0000 | |
| 134 | F | A | 0.0000 | |
| 135 | V | A | 0.0000 | |
| 136 | T | A | 0.0000 | |
| 137 | R | A | -1.4882 | |
| 138 | I | A | 0.0000 | |
| 139 | M | A | -1.5908 | |
| 140 | Q | A | -2.0226 | |
| 141 | D | A | -2.8065 | |
| 142 | F | A | -2.1226 | |
| 143 | E | A | -2.7163 | |
| 144 | S | A | -2.2668 | |
| 145 | D | A | -2.5464 | |
| 146 | T | A | -0.9061 | |
| 147 | F | A | 0.5499 | |
| 148 | F | A | 0.0000 | |
| 149 | P | A | -1.1657 | |
| 150 | E | A | -1.9559 | |
| 151 | I | A | -2.0866 | |
| 152 | D | A | -2.8546 | |
| 153 | L | A | -1.2044 | |
| 154 | E | A | -2.7458 | |
| 155 | K | A | -3.7076 | |
| 156 | Y | A | 0.0000 | |
| 157 | K | A | -1.9371 | |
| 158 | L | A | 0.1096 | |
| 159 | L | A | -0.4237 | |
| 160 | P | A | -0.9463 | |
| 161 | E | A | -1.6254 | |
| 162 | Y | A | -0.5665 | |
| 163 | P | A | -0.4916 | |
| 164 | G | A | -0.3140 | |
| 165 | V | A | 0.0430 | |
| 166 | L | A | 0.5668 | |
| 167 | S | A | -0.7695 | |
| 168 | D | A | -1.4115 | |
| 169 | V | A | -1.0253 | |
| 170 | Q | A | -1.6819 | |
| 171 | E | A | -3.0380 | |
| 172 | E | A | -2.9564 | |
| 173 | K | A | -2.9604 | |
| 174 | G | A | -2.1930 | |
| 175 | I | A | 0.0000 | |
| 176 | K | A | -2.6281 | |
| 177 | Y | A | 0.0000 | |
| 178 | K | A | -1.3542 | |
| 179 | F | A | 0.0000 | |
| 180 | E | A | 0.0000 | |
| 181 | V | A | 0.0000 | |
| 182 | Y | A | 0.0000 | |
| 183 | E | A | -1.3292 | |
| 184 | K | A | 0.0000 | |
| 185 | N | A | -3.0921 | |
| 186 | D | A | -3.0717 |
Automated mutations analysis
In the automated mutations mode, the server selects aggregation prone resides
and each selected residue is mutated to glutamic acid, lysine, aspartic acid and arginine.
The table below shows 2 best scored mutants for each mutated residue. Protein variants
are ordered according to the mutation effect they had on protein stability
(energetic effect) together with the difference in the average per-residue aggregation score
between the wild type and the mutant (in the table green values indicate a positive change,
grey are neutral, and orange/red mean destabilizing or more aggregation prone mutants).
Summary for all the mutants can be found in this
CSV file.
Mutant |
Energetic effect |
Score comparison |
|||
| VR1A | -1.3973 | -0.0641 | View | CSV | PDB |
| VK1A | -0.4218 | -0.0756 | View | CSV | PDB |
| LD166A | 0.0022 | -0.0703 | View | CSV | PDB |
| FK147A | 0.018 | -0.0729 | View | CSV | PDB |
| MK111A | 0.013 | -0.0277 | View | CSV | PDB |
| LR166A | 0.1077 | -0.0727 | View | CSV | PDB |
| FR147A | 0.2669 | -0.0859 | View | CSV | PDB |
| MR111A | 0.4586 | -0.0383 | View | CSV | PDB |
| GK2A | 0.8789 | -0.0427 | View | CSV | PDB |
| GR2A | 1.3377 | -0.0545 | View | CSV | PDB |
| VR115A | 1.4607 | -0.0199 | View | CSV | PDB |
| VK115A | 2.4012 | -0.0253 | View | CSV | PDB |